DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp8a and Obp83cd

DIOPT Version :10

Sequence 1:NP_727322.1 Gene:Obp8a / 31860 FlyBaseID:FBgn0030103 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_649612.1 Gene:Obp83cd / 40746 FlyBaseID:FBgn0046878 Length:242 Species:Drosophila melanogaster


Alignment Length:145 Identity:31/145 - (21%)
Similarity:50/145 - (34%) Gaps:35/145 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GLLSRLLLLLLVVELTPPAIPVPMRSSPQSLALLRAR----DQCGRE---LTA--AQRLQLDRMQ 63
            |:|..|.|.|               |..:.||||...    ::|.:.   |||  |:||:..:..
  Fly     6 GILIALCLCL---------------SLNEGLALLEHEGETINRCIQNYGGLTAENAERLERFKEW 55

  Fly    64 FEDAAHVRHYLHCFWSRL-QLWLDETGFQAQRIVQSFGGERRLNVEQALPAINGCNAKTSSRGSG 127
            .:....:..:..|:.|.: ..:.:.|||....||..||          .|....|..|.......
  Fly    56 SDSYEEIPCFTRCYLSEMFDFYNNLTGFNKDGIVGVFG----------RPVYEACRKKLELPFES 110

  Fly   128 AQTVVDWCFRAFVCV 142
            .::.....:..|.|:
  Fly   111 GESSCKHAYEGFHCI 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp8aNP_727322.1 PhBP 43..144 CDD:214783 21/110 (19%)
Obp83cdNP_649612.1 PhBP 30..129 CDD:214783 21/106 (20%)
PhBP 149..242 CDD:214783
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.