DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp8a and Obp83a

DIOPT Version :9

Sequence 1:NP_727322.1 Gene:Obp8a / 31860 FlyBaseID:FBgn0030103 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_001287190.1 Gene:Obp83a / 40737 FlyBaseID:FBgn0011281 Length:174 Species:Drosophila melanogaster


Alignment Length:92 Identity:21/92 - (22%)
Similarity:40/92 - (43%) Gaps:6/92 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RRSQIGLLSRLLLLLLVVELTPPAIPVPMRSSPQSLALLRAR---DQCGRE--LTAAQRLQLDRM 62
            ||....:|...|.||....:.|||......:.|....|..|:   |.|..:  :|.|...:....
  Fly    28 RRVSASVLLIALSLLSGALILPPAAAQRDENYPPPGILKMAKPFHDACVEKTGVTEAAIKEFSDG 92

  Fly    63 QFEDAAHVRHYLHCFWSRLQLWLDETG 89
            :..:...::.|::||:..::: :|:.|
  Fly    93 EIHEDEKLKCYMNCFFHEIEV-VDDNG 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp8aNP_727322.1 PhBP 43..144 CDD:214783 10/52 (19%)
Obp83aNP_001287190.1 PBP_GOBP 64..166 CDD:279703 11/56 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452904
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.