DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp8a and Obp56e

DIOPT Version :10

Sequence 1:NP_727322.1 Gene:Obp8a / 31860 FlyBaseID:FBgn0030103 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_611445.1 Gene:Obp56e / 37267 FlyBaseID:FBgn0034471 Length:132 Species:Drosophila melanogaster


Alignment Length:141 Identity:30/141 - (21%)
Similarity:55/141 - (39%) Gaps:39/141 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 AIPVPMRSSPQSLALLRARDQCGRE--LTAAQRLQLDRMQFEDA-AHVRHYLHCFWSRLQLWLDE 87
            |..|.:..|.::.|..||: .|.::  :|..|.:.|....|.|: ..|:.:.:||       |::
  Fly    16 ASAVGLTDSQKAEAKQRAK-ACVKQEGITKEQAIALRSGNFADSDPKVKCFANCF-------LEQ 72

  Fly    88 TGFQAQRIVQ---------SFGGERRLNVEQALPAINGCNAKTSSRGSGAQTVVDWCFRAFVCVL 143
            ||..|...::         ...||..:...||     .|:   |::|:..   .|..:..:.|  
  Fly    73 TGLVANGQIKPDVVLAKLGPIAGEANVKEVQA-----KCD---STKGADK---CDTSYLLYKC-- 124

  Fly   144 ATPVGEWYKRH 154
                  :|:.|
  Fly   125 ------YYENH 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp8aNP_727322.1 PhBP 43..144 CDD:214783 23/112 (21%)
Obp56eNP_611445.1 PBP_GOBP 21..128 CDD:460193 27/133 (20%)

Return to query results.
Submit another query.