DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp8a and Obp56b

DIOPT Version :10

Sequence 1:NP_727322.1 Gene:Obp8a / 31860 FlyBaseID:FBgn0030103 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_611443.1 Gene:Obp56b / 37265 FlyBaseID:FBgn0046880 Length:137 Species:Drosophila melanogaster


Alignment Length:140 Identity:29/140 - (20%)
Similarity:56/140 - (40%) Gaps:17/140 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RLLLLLLVVELTPPAIPVPMRSSPQSLALLRARDQCGREL----TAAQRLQLDRMQFEDAAHVRH 72
            :|:.||:|..:...:..|..:|:.:..|..:.:..|.:||    :.|..|..|:.....:..|:.
  Fly     2 KLIYLLVVFLIFALSELVAGQSAAELAAYKQIQQACIKELNIAASDANLLTTDKEVANPSESVKC 66

  Fly    73 YLHCFWSRLQLWLDETGFQAQRIVQ----SFGGERRLNVEQALPAINGCNAKTSSRGSGAQTVVD 133
            |..|.:.:|.|..|:......:||:    .|..   |.|::....:..|....|:      ...|
  Fly    67 YHSCVYKKLGLLGDDGKPNTDKIVKLAQIRFSS---LPVDKLKSLLTSCGTTKSA------ATCD 122

  Fly   134 WCFRAFVCVL 143
            :.:....||:
  Fly   123 FVYNYEKCVV 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp8aNP_727322.1 PhBP 43..144 CDD:214783 22/109 (20%)
Obp56bNP_611443.1 PhBP 35..135 CDD:214783 22/107 (21%)

Return to query results.
Submit another query.