DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp8a and Obp44a

DIOPT Version :10

Sequence 1:NP_727322.1 Gene:Obp8a / 31860 FlyBaseID:FBgn0030103 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_610358.1 Gene:Obp44a / 35789 FlyBaseID:FBgn0033268 Length:143 Species:Drosophila melanogaster


Alignment Length:107 Identity:27/107 - (25%)
Similarity:45/107 - (42%) Gaps:9/107 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LLRARDQC--GRELTAAQRLQLDRMQFEDAAHVRHYLHCFWSRLQLWLDETGFQAQRIVQSFGGE 102
            |..||.:|  ..::|.|...:.....:.|....|:|:.|.:.:..|:.:..||:.:.:|...|..
  Fly    29 LQSARKECAASSKVTEALIAKYKTFDYPDDDITRNYIQCIFVKFDLFDEAKGFKVENLVAQLGQG 93

  Fly   103 RRLNVEQALPA-INGCNAKTSSRGSGAQTVVDWCFRAFVCVL 143
            :  ..:.||.| |..|..|...:....    :|.||.|.|.|
  Fly    94 K--EDKAALKADIEKCADKNEQKSPAN----EWAFRGFKCFL 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp8aNP_727322.1 PhBP 43..144 CDD:214783 26/104 (25%)
Obp44aNP_610358.1 PhBP 32..132 CDD:214783 26/104 (25%)

Return to query results.
Submit another query.