powered by:
Protein Alignment Obp8a and Obp28a
DIOPT Version :9
Sequence 1: | NP_727322.1 |
Gene: | Obp8a / 31860 |
FlyBaseID: | FBgn0030103 |
Length: | 163 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_523505.1 |
Gene: | Obp28a / 34031 |
FlyBaseID: | FBgn0011283 |
Length: | 143 |
Species: | Drosophila melanogaster |
Alignment Length: | 56 |
Identity: | 13/56 - (23%) |
Similarity: | 23/56 - (41%) |
Gaps: | 9/56 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 95 IVQSFGGERRL-----NVEQALPAINGCNAKTSS--RGSGAQTVVDWCFRAFVCVL 143
:|::|..:..| :.|..:|.:...:|.... :...|.|....|.|| ||:
Fly 18 LVRAFDEKEALAKLMESAESCMPEVGATDADLQEMVKKQPASTYAGKCLRA--CVM 71
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Obp8a | NP_727322.1 |
PhBP |
43..144 |
CDD:214783 |
13/56 (23%) |
Obp28a | NP_523505.1 |
PhBP |
35..134 |
CDD:214783 |
10/39 (26%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45452917 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR11857 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.