powered by:
Protein Alignment Obp8a and Obp57e
DIOPT Version :9
Sequence 1: | NP_727322.1 |
Gene: | Obp8a / 31860 |
FlyBaseID: | FBgn0030103 |
Length: | 163 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_611488.1 |
Gene: | Obp57e / 326110 |
FlyBaseID: | FBgn0050145 |
Length: | 136 |
Species: | Drosophila melanogaster |
Alignment Length: | 49 |
Identity: | 12/49 - (24%) |
Similarity: | 16/49 - (32%) |
Gaps: | 13/49 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 106 NVEQALPAINGCNAKTS-SRGSGAQTVVDW----------CFRAFVCVL 143
||.......|.|.::.. |.....|.:.:| || ..|||
Fly 17 NVLANTSVFNPCVSQNELSEYEAHQVMENWPVPPIDRAYKCF--LTCVL 63
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Obp8a | NP_727322.1 |
PhBP |
43..144 |
CDD:214783 |
12/49 (24%) |
Obp57e | NP_611488.1 |
PhBP |
28..123 |
CDD:214783 |
9/38 (24%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR11857 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.