DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp8a and Obp83g

DIOPT Version :9

Sequence 1:NP_727322.1 Gene:Obp8a / 31860 FlyBaseID:FBgn0030103 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_731043.1 Gene:Obp83g / 170878 FlyBaseID:FBgn0046875 Length:146 Species:Drosophila melanogaster


Alignment Length:116 Identity:23/116 - (19%)
Similarity:46/116 - (39%) Gaps:12/116 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RARDQCGRELTAAQRLQLDRMQFEDAAHVRH--YLHCFWSRLQLWLDETGFQAQRIVQSFGGERR 104
            :|.::|..:......:....:.:|..||.|.  ::.||..:|:|:.::.||..:.::..|..:..
  Fly    35 KAFEECREDYYVPDDIYEKYLNYEFPAHRRTSCFVKCFLEKLELFSEKKGFDERAMIAQFTSKSS 99

  Fly   105 LNVEQALPAINGCNAKTSSRGSGAQTVVDWCFRAFVCVLATPVGEWYKRHM 155
            .::......:..|    .........|..|..|.|.|.|  |:    .||:
  Fly   100 KDLSTVQHGLEKC----IDHNEAESDVCTWANRVFSCWL--PI----NRHV 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp8aNP_727322.1 PhBP 43..144 CDD:214783 19/102 (19%)
Obp83gNP_731043.1 PBP_GOBP 22..134 CDD:279703 19/102 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450217
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.