DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31115 and mtap

DIOPT Version :9

Sequence 1:NP_733068.2 Gene:CG31115 / 318597 FlyBaseID:FBgn0051115 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001011495.1 Gene:mtap / 496996 XenbaseID:XB-GENE-971776 Length:280 Species:Xenopus tropicalis


Alignment Length:265 Identity:125/265 - (47%)
Similarity:175/265 - (66%) Gaps:0/265 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IKIGIIGEANLDKPIYLAERMEYAVCTPFGKPSDVIIDGQIEGVNVCLLSRNGRNHDIMPSNINY 82
            :|:||||.:.||.|..|..|:|..|.||||||||.::.|:|:.|:..||:|:||.|.|.|:|:||
 Frog     7 VKVGIIGGSGLDDPDILEGRLEKYVDTPFGKPSDALVLGKIKNVDCVLLARHGRQHTIAPTNVNY 71

  Fly    83 RANVWAMRKMGCTHILVTNTFSSLRDTFQPGHLVVPNDVIDYTSRRAQTFYDGAVGSPLGVCHVP 147
            |||:||::..||||||||....|||:..|||.:|:.:..||.|::|.||||||......||||:|
 Frog    72 RANIWALKSEGCTHILVTTACGSLREEIQPGDIVIVDQFIDRTTKREQTFYDGGPSCLPGVCHIP 136

  Fly   148 MNPTFCERTRQHLLSAAEELGFPTGSSGTVLTLEGPRYSTVAENNMFRKWGADLLSMTLCPEAIL 212
            |...||.:||:.|:..|:.||....|.|.::|:||||:|:.||:.|||.||||:::||..||.||
 Frog   137 MAEPFCAKTREVLIDIAKRLGIKCHSKGAMITIEGPRFSSKAESQMFRLWGADVINMTTVPEVIL 201

  Fly   213 AKEAGIPYASLGLVTNMECWCAKQPNATTHEIIYIFKKQSENLQKVLITAIRNMAAEDWAEDILK 277
            ||||||.|||:.:.|:.:||...:...:...::...|:.:.....:|:|||..:||.||.|.:..
 Frog   202 AKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKATSILLTAIPQIAAMDWTELLQS 266

  Fly   278 AKILV 282
            .|..|
 Frog   267 MKSTV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31115NP_733068.2 XapA 12..266 CDD:223084 118/247 (48%)
PNP_UDP_1 19..264 CDD:294213 117/244 (48%)
mtapNP_001011495.1 MTAP_SsMTAPII_like_MTIP 9..252 CDD:350161 115/242 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1616485at2759
OrthoFinder 1 1.000 - - FOG0004468
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3167
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.