DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31115 and pnp5b

DIOPT Version :9

Sequence 1:NP_733068.2 Gene:CG31115 / 318597 FlyBaseID:FBgn0051115 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001004628.1 Gene:pnp5b / 447889 ZFINID:ZDB-GENE-040912-54 Length:294 Species:Danio rerio


Alignment Length:228 Identity:55/228 - (24%)
Similarity:92/228 - (40%) Gaps:26/228 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IIDGQIEGVN-VCLLSRNGRNH---------DIMPSNINYRANVWAMRKMGCTHILVTNTFSSLR 107
            ::.|.::|.. ||:   .||.|         ..||..:        .:.||...:::||....|.
Zfish    72 LVFGTLKGKPCVCM---QGRFHLYEGYAIQKTTMPIRV--------FKLMGVETVILTNAAGGLN 125

  Fly   108 DTFQPGHLVVPNDVIDYTSRRAQTFYDGAVGSPLGVCHVPMNPTFCERTRQHLLSAAEELGFPT- 171
            ..|:.|.:::..|.|:...........||.....||....|:..:....:|.:.:.|:||.|.. 
Zfish   126 QDFKVGDIMIIKDHINIPGFAGHNPLVGANDDRFGVRFPCMSDAYDRDLQQLVRAVADELDFSVF 190

  Fly   172 GSSGTVLTLEGPRYSTVAENNMFRKWGADLLSMTLCPEAILAKEAGIPYASLGLVTNMECWCAKQ 236
            ...|....|.||.:.|:||....|:.|||.:.|:...|.|:|:...:...:|.|:||......:.
Zfish   191 MRDGVYSVLGGPSFETIAECRALRQLGADAVGMSTVHEVIVARHCDMRVLALSLITNKAVMDYQS 255

  Fly   237 PNATTHEIIY----IFKKQSENLQKVLITAIRN 265
            .....||.:.    :..||.|.|...:::.|.|
Zfish   256 EKKANHEEVLETGALRAKQMEKLVSTVVSRIPN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31115NP_733068.2 XapA 12..266 CDD:223084 55/228 (24%)
PNP_UDP_1 19..264 CDD:294213 53/225 (24%)
pnp5bNP_001004628.1 PRK08202 11..286 CDD:236183 53/224 (24%)
XapA 16..286 CDD:223084 53/224 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.