DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31115 and pnp4b

DIOPT Version :9

Sequence 1:NP_733068.2 Gene:CG31115 / 318597 FlyBaseID:FBgn0051115 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_991206.1 Gene:pnp4b / 402940 ZFINID:ZDB-GENE-040426-1887 Length:304 Species:Danio rerio


Alignment Length:229 Identity:61/229 - (26%)
Similarity:99/229 - (43%) Gaps:24/229 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 CTPFGK---PSDVIIDGQI---EGVNVCLLSRNGRNHDIMPSNINYRANVWAMRKMGCTHILVTN 101
            |..||:   .|.|.:.|:.   ||.::|.::        .|..|        .:.||...|:|||
Zfish    72 CLVFGQIKGKSCVFMQGRFHLYEGYSLCKVT--------FPVRI--------FKLMGVETIIVTN 120

  Fly   102 TFSSLRDTFQPGHLVVPNDVIDYTSRRAQTFYDGAVGSPLGVCHVPMNPTFCERTRQHLLSAAEE 166
            ....|...|:.|.::|..|.|:......|....|......|:....|:..:.:..|:.::....|
Zfish   121 ASGGLCQDFKVGDIMVIKDHINLPGFAGQHPLCGPNDERFGIRFPCMSDAYSKDLRKLVMDITAE 185

  Fly   167 LGFPT-GSSGTVLTLEGPRYSTVAENNMFRKWGADLLSMTLCPEAILAKEAGIPYASLGLVTN-M 229
            ||:.. ...|....:.||.:.|:||..|....|:|.:.|:..||..:||..|:....|.|:|| :
Zfish   186 LGYSNFVHEGVYCMVSGPNFETIAEARMLHILGSDSVGMSTVPEVTVAKHCGLRVMGLSLITNKV 250

  Fly   230 ECWCAKQPNATTHEIIYIFKKQSENLQKVLITAI 263
            ....:::......|::.|.|.::|.||.||||.|
Zfish   251 SLDYSREEKVNHEEVLQISKMRAEMLQNVLITFI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31115NP_733068.2 XapA 12..266 CDD:223084 61/229 (27%)
PNP_UDP_1 19..264 CDD:294213 61/229 (27%)
pnp4bNP_991206.1 PRK08202 18..286 CDD:236183 61/229 (27%)
XapA 25..286 CDD:223084 61/229 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0005
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.