DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31115 and CG18128

DIOPT Version :9

Sequence 1:NP_733068.2 Gene:CG31115 / 318597 FlyBaseID:FBgn0051115 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_611822.1 Gene:CG18128 / 37756 FlyBaseID:FBgn0034898 Length:339 Species:Drosophila melanogaster


Alignment Length:228 Identity:53/228 - (23%)
Similarity:85/228 - (37%) Gaps:50/228 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KIGIIGEANLDKPIYLAERMEYAVCTPFG---------KPSDVIIDGQIEGVNVCLLSRNGRNHD 74
            |.|:|..:.|...:.|.|:   .|..|:.         :|....:.|.:.|..:..|..:..:.|
  Fly    66 KYGLICGSFLSDMVSLVEQ---PVVIPYEDIPNFPDGIEPDCSFVLGTVMGAPIIALVHSFHSCD 127

  Fly    75 -------IMPSNINYRANVWAMRKMGCTHILVTNTFSSLRDTFQPGHLVVPNDVIDYTSRRAQTF 132
                   .:|        |..|:..|...|::|:..:::...|..|.:::..|.|:......||.
  Fly   128 GYNLATCALP--------VRVMQLCGVRTIMLTSEAAAVDHGFALGDIMLVQDHINVVGMMHQTP 184

  Fly   133 YDGAVGSPLGVCHVPMNPTFCERT-------RQHLLSAAEELGFPTG-----SSGTVLTLEGPRY 185
            .:|           |.:|.|..|.       .:.||..|.|:|...|     .||.:..:.||..
  Fly   185 LEG-----------PSDPRFGSRRFSMVNAYDKDLLEKALEIGKRMGIQKFLHSGVLACMGGPIL 238

  Fly   186 STVAENNMFRKWGADLLSMTLCPEAILAKEAGI 218
            .||||..|.|......:.|:|.||.|.|...|:
  Fly   239 GTVAEERMLRTMEVSAVGMSLVPEVIAAHHGGL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31115NP_733068.2 XapA 12..266 CDD:223084 53/228 (23%)
PNP_UDP_1 19..264 CDD:294213 53/228 (23%)
CG18128NP_611822.1 PNP_UDP_1 46..280 CDD:294213 53/228 (23%)
XapA 50..280 CDD:223084 53/228 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449087
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0005
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.