DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31115 and Pnp

DIOPT Version :9

Sequence 1:NP_733068.2 Gene:CG31115 / 318597 FlyBaseID:FBgn0051115 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_038660.1 Gene:Pnp / 18950 MGIID:97365 Length:289 Species:Mus musculus


Alignment Length:223 Identity:53/223 - (23%)
Similarity:96/223 - (43%) Gaps:9/223 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IIDGQIEGVNVCLLSRNGRNH---DIMPSNINYRANVWAMRKMGCTHILVTNTFSSLRDTFQPGH 114
            ::.|.:.|  .|.:...||.|   ....|.:.:...|:.:  :|...::|||....|...|:.|.
Mouse    68 LVFGLLNG--RCCVMMQGRFHMYEGYSLSKVTFPVRVFHL--LGVETLVVTNAAGGLNPNFEVGD 128

  Fly   115 LVVPNDVIDYTSRRAQTFYDGAVGSPLGVCHVPMNPTFCERTRQHLLSAAEELGFPTG-SSGTVL 178
            :::..|.|:......|....|......||....|:..:....||...||.:::|.... ..||.:
Mouse   129 IMLIRDHINLPGFCGQNPLRGPNDERFGVRFPAMSDAYDRDMRQKAFSAWKQMGEQRKLQEGTYV 193

  Fly   179 TLEGPRYSTVAENNMFRKWGADLLSMTLCPEAILAKEAGIPYASLGLVTNMECWCAKQPNATTH- 242
            .|.||.:.||||:.:.:..|||.:.|:..||.|:|:..|:......|:||......:......| 
Mouse   194 MLAGPNFETVAESRLLKMLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVVMDYENLEKANHM 258

  Fly   243 EIIYIFKKQSENLQKVLITAIRNMAAED 270
            |::...|..::.|::.:...:.::...|
Mouse   259 EVLDAGKAAAQTLERFVSILMESIPLPD 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31115NP_733068.2 XapA 12..266 CDD:223084 52/217 (24%)
PNP_UDP_1 19..264 CDD:294213 52/215 (24%)
PnpNP_038660.1 XapA 11..283 CDD:223084 52/218 (24%)
PNPH 26..280 CDD:273764 52/215 (24%)
Phosphate binding. /evidence=ECO:0000250|UniProtKB:P55859 84..86 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0005
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.