DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31111 and TBRG1

DIOPT Version :9

Sequence 1:NP_733074.1 Gene:CG31111 / 318595 FlyBaseID:FBgn0051111 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_116200.2 Gene:TBRG1 / 84897 HGNCID:29551 Length:411 Species:Homo sapiens


Alignment Length:320 Identity:98/320 - (30%)
Similarity:153/320 - (47%) Gaps:57/320 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NLKYKRRYESLKRSVKSYLLENAALTDEICRLQAELSVTRSQRLYLIERLMFHEGLEK------- 59
            |.||:.:|..|:::.|:.:.||||:.|||.||:.:....:.:|.||:::|:..:.|.:       
Human    31 NEKYRLKYLRLRKAAKATVFENAAICDEIARLEEKFLKAKEERRYLLKKLLQLQALTEGEVQAAA 95

  Fly    60 -SNSGRPSVSNGKNDAAETTKKYSPVVSHKNPVED--------------KPKNVTIVRKK----- 104
             |:|....::.|...:..|.:...|:.......|:              |..|...|.||     
Human    96 PSHSSSLPLTYGVASSVGTIQGAGPISGPSTGAEEPFGKKTKKEKKEKGKENNKLEVLKKTCKKK 160

  Fly   105 -------------------KPMFPMNLNNVLLHSLGEIISVNPNFHTESWIYPVGYVATRIYAHP 150
                               :|:||:.|..:.::||||||:..|.||.||.||||||.:|||||..
Human   161 KMAGGARKLVQPIALDPSGRPVFPIGLGGLTVYSLGEIITDRPGFHDESAIYPVGYCSTRIYASM 225

  Fly   151 KDPRKKCVFTCKILNNAGIPQFQIIPDNDLDGVFFGESANMCHMELLNSIQRSPCVKIKIPFDVQ 215
            |.|.:||::||:|.:....|||:|:|::|........||:.||.|||.:|. :...|:.......
Human   226 KCPDQKCLYTCQIKDGGVQPQFEIVPEDDPQNAIVSSSADACHAELLRTIS-TTMGKLMPNLLPA 289

  Fly   216 GEVFFGLSNQKTQSLLMMDPAFHQCTNFK--GFAV------QNVQSL--NSASLSFETLQ 265
            |..|||.|:....:|:...|...:|.|::  .|.|      |..:.|  |.|::|||..|
Human   290 GADFFGFSHPAIHNLIQSCPGARKCINYQWVKFDVCKPGDGQLPEGLPENDAAMSFEAFQ 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31111NP_733074.1 FYRN 114..163 CDD:283589 28/48 (58%)
FYRC 171..246 CDD:197781 23/76 (30%)
TBRG1NP_116200.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..146 2/26 (8%)
FYRN 189..238 CDD:283589 28/48 (58%)
FYRC 244..319 CDD:283590 24/75 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148768
Domainoid 1 1.000 64 1.000 Domainoid score I10098
eggNOG 1 0.900 - - E2759_KOG4443
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H18102
Inparanoid 1 1.050 137 1.000 Inparanoid score I4544
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1397649at2759
OrthoFinder 1 1.000 - - FOG0005809
OrthoInspector 1 1.000 - - oto88544
orthoMCL 1 0.900 - - OOG6_105977
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5170
SonicParanoid 1 1.000 - - X4784
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.690

Return to query results.
Submit another query.