DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31111 and KMT2D

DIOPT Version :9

Sequence 1:NP_733074.1 Gene:CG31111 / 318595 FlyBaseID:FBgn0051111 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_011537072.1 Gene:KMT2D / 8085 HGNCID:7133 Length:5556 Species:Homo sapiens


Alignment Length:184 Identity:41/184 - (22%)
Similarity:86/184 - (46%) Gaps:23/184 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 PVVSHKNPVE----------------DKPKNV-TIVRKKKPMFPMNLNNVLLHSLGEIISVN-PN 129
            |:...|.|.|                |:.|.: :|:::.:.:....:..::.|::|:::... .:
Human  5137 PMHKIKGPCEQELSSFAVFRRVYIERDEVKQIASIIQRGERLHMFRVGGLVFHAIGQLLPHQMAD 5201

  Fly   130 FHTESWIYPVGYVATRIYAHPKDPRKKCVFTCKILNNAGIPQFQI-IPDNDLDGVFFGESANMC- 192
            ||:.:.:|||||.|||||...:...::|.:.|.|..|.|.|:|.| :.:..|:.:.|.:::... 
Human  5202 FHSATALYPVGYEATRIYWSLRTNNRRCCYRCSIGENNGRPEFVIKVIEQGLEDLVFTDASPQAV 5266

  Fly   193 ---HMELLNSIQRSPCVKIKIPFDVQGEVFFGLSNQKTQSLLMMDPAFHQCTNF 243
               .:|.:.::::...:....|..::||..|||:......:....|....|.|:
Human  5267 WNRIIEPVAAMRKEADMLRLFPEYLKGEELFGLTVHAVLRIAESLPGVESCQNY 5320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31111NP_733074.1 FYRN 114..163 CDD:283589 16/49 (33%)
FYRC 171..246 CDD:197781 14/78 (18%)
KMT2DXP_011537072.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.