DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31111 and KMT2C

DIOPT Version :9

Sequence 1:NP_733074.1 Gene:CG31111 / 318595 FlyBaseID:FBgn0051111 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_005250082.1 Gene:KMT2C / 58508 HGNCID:13726 Length:4983 Species:Homo sapiens


Alignment Length:154 Identity:36/154 - (23%)
Similarity:69/154 - (44%) Gaps:12/154 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 TIVRKKKPMFPMNLNNVLLHSLGEIISVNPN-FHTESWIYPVGYVATRIYAHPKDPRKKCVFTCK 162
            :||::.:......:.:::.|::|:::..... ||:...::||||.|:|:|...:...::|.:.|.
Human  4609 SIVQRGERDHTFRVGSLIFHTIGQLLPQQMQAFHSPKALFPVGYEASRLYWSTRYANRRCRYLCS 4673

  Fly   163 ILNNAGIPQF--QIIPDNDLDGVFFGESANMCHMELLNSIQRSPCVKIK------IPFDVQGEVF 219
            |....|.|.|  :|:.....|.|....|......::|..:   .||:.|      .|..::||..
Human  4674 IEEKDGRPVFVIRIVEQGHEDLVLSDISPKGVWDKILEPV---ACVRKKSEMLQLFPAYLKGEDL 4735

  Fly   220 FGLSNQKTQSLLMMDPAFHQCTNF 243
            |||:......:....|....|.|:
Human  4736 FGLTVSAVARIAESLPGVEACENY 4759

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31111NP_733074.1 FYRN 114..163 CDD:283589 13/49 (27%)
FYRC 171..246 CDD:197781 18/81 (22%)
KMT2CXP_005250082.1 ePHD1_KMT2C 248..331 CDD:277166
PHD1_KMT2C_like 344..389 CDD:276984
PHD2_KMT2C 391..436 CDD:277069
PHD3_KMT2C 467..518 CDD:276986
PHD4_KMT2C 953..1009 CDD:277071
PHD5_KMT2C_like 1010..1056 CDD:276988
RanBP2-type Zn finger 1085..1107 CDD:275375
PHD6_KMT2C 1087..1137 CDD:277073
HMG-box 1671..1722 CDD:294061
DUF2962 1709..>1792 CDD:288077
SYCE1 <3198..3287 CDD:291886
ePHD2_KMT2C 4474..4578 CDD:277167
FYRN 4624..4674 CDD:283589 13/49 (27%)
FYRC 4680..4761 CDD:283590 19/83 (23%)
SET <4797..4983 CDD:225491
SET 4844..4965 CDD:214614
PostSET 4967..4983 CDD:214703
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.