DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31111 and tbrg1

DIOPT Version :9

Sequence 1:NP_733074.1 Gene:CG31111 / 318595 FlyBaseID:FBgn0051111 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_012812273.1 Gene:tbrg1 / 493502 XenbaseID:XB-GENE-962046 Length:430 Species:Xenopus tropicalis


Alignment Length:326 Identity:93/326 - (28%)
Similarity:144/326 - (44%) Gaps:76/326 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KYKRRYESLKRSVKSYLLENAALTDEICRLQAELSVTRSQRLYLIERLMFHEGLEKSNSGRPSVS 68
            ||:.:...|:|..|..:.|||||.|||.|.:.:....:.:|.:|::||:..:.|.:...|....|
 Frog    54 KYRLKCLRLRRVAKDMVFENAALCDEIARTEDKFIRAKEERRFLLKRLLQLQALSEEEPGTSHNS 118

  Fly    69 N------------------------------------------GKNDAAETTKKYSPVVSHKNPV 91
            |                                          ||.:.:|..||.|         
 Frog   119 NVSAGYSVPDMAAMNEGNLDMCYSSVLDDGGSCKKVKKDKREKGKENKSEAMKKPS--------- 174

  Fly    92 EDKPKNVT--IVRK----------KKPMFPMNLNNVLLHSLGEIISVNPNFHTESWIYPVGYVAT 144
              |.|.||  ..||          .:|:||:.|..:.::|||||||....||.:..|||||:.:|
 Frog   175 --KKKRVTEGTTRKWVQPIALDPCGRPVFPIVLEGLTVYSLGEIISDRAGFHEKVAIYPVGFCST 237

  Fly   145 RIYAHPKDPRKKCVFTCKILNNAGIPQFQIIPDNDLDGVFFGESANMCHMELLNSIQRSPCVKIK 209
            |:|...|:|.:||::||:|.:....|||:|:||:|........||:.||..||..|......:..
 Frog   238 RVYVGMKNPDQKCLYTCQIKDGGTGPQFEIVPDDDPQNSIVASSADECHSILLQKISTPLGKRFS 302

  Fly   210 IPFDVQGEVFFGLSNQKTQSLLMMDPAFHQCTNFKGFAVQNVQS----------LNSASLSFETL 264
            .| |:.|..|||.::...|:|:...|...:||.::....:..::          .:|||::||..
 Frog   303 TP-DLAGAYFFGFTHPTIQNLIQSCPGARKCTGYQWVKFEVCRAGEEQVPRDICESSASVNFEAF 366

  Fly   265 Q 265
            |
 Frog   367 Q 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31111NP_733074.1 FYRN 114..163 CDD:283589 23/48 (48%)
FYRC 171..246 CDD:197781 24/74 (32%)
tbrg1XP_012812273.1 FYRN 207..256 CDD:368685 23/48 (48%)
FYRC 262..343 CDD:368686 25/81 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10701
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H18102
Inparanoid 1 1.050 127 1.000 Inparanoid score I4536
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1397649at2759
OrthoFinder 1 1.000 - - FOG0005809
OrthoInspector 1 1.000 - - otm47579
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5170
SonicParanoid 1 1.000 - - X4784
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.