DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31111 and Tbrg1

DIOPT Version :9

Sequence 1:NP_733074.1 Gene:CG31111 / 318595 FlyBaseID:FBgn0051111 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001009344.2 Gene:Tbrg1 / 300521 RGDID:1305123 Length:406 Species:Rattus norvegicus


Alignment Length:314 Identity:95/314 - (30%)
Similarity:148/314 - (47%) Gaps:55/314 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NLKYKRRYESLKRSVKSYLLENAALTDEICRLQAELSVTRSQRLYLIERLMFHEGLEK------- 59
            |.||:.:|..|:|:.|:.:.||||:.|||.||:.:....:.:|.||:::|:....|.:       
  Rat    30 NEKYRLKYLRLRRAAKATVFENAAVCDEIARLEEKFLKAKEERRYLLKKLLQIHALTEGEPQAAA 94

  Fly    60 -SNSGRPSVSNGKNDAAETTKKYSPVVSHKNPVEDKPK----------------NVTIVRKK--- 104
             |:|....::.|...:..|.:...|....:.|...|.|                ..|..|||   
  Rat    95 PSHSSSLPLAYGVTSSVGTIQGAGPSTGAEEPFAKKSKKEKKEKGKENSKLEVLKKTSKRKKMEG 159

  Fly   105 ---------------KPMFPMNLNNVLLHSLGEIISVNPNFHTESWIYPVGYVATRIYAHPKDPR 154
                           :|:||:.|..:.::||||||:..|.||.|:.||||||.:||:||..|.|.
  Rat   160 GARKLVRPIALDPSGQPVFPIGLGGLTVYSLGEIITNRPGFHDENAIYPVGYCSTRVYASMKCPD 224

  Fly   155 KKCVFTCKILNNAGIPQFQIIPDNDLDGVFFGESANMCHMELLNSIQRSPCVKIKIPFDVQGEVF 219
            :||::||:|.:....|||:|:|::|......|.||:.|:.|||.:|..:....:..|... |..|
  Rat   225 QKCLYTCQIKDGGVQPQFEIVPEDDPRNTIVGSSADACYEELLRAISAATGKLMPNPLSC-GADF 288

  Fly   220 FGLSNQKTQSLLMMDPAFHQCTNF-----------KGFAVQNVQSLNSASLSFE 262
            ||.|:....:|:...|....|.|:           ||...|.:.. |.|::|.|
  Rat   289 FGFSHPTIHNLIQSCPEAQNCVNYQWVKFDACKPRKGQLSQELPE-NDAAMSLE 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31111NP_733074.1 FYRN 114..163 CDD:283589 26/48 (54%)
FYRC 171..246 CDD:197781 24/85 (28%)
Tbrg1NP_001009344.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..144 4/27 (15%)
FYRN 183..233 CDD:399155 26/49 (53%)
FYRC 239..320 CDD:399156 24/81 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342662
Domainoid 1 1.000 63 1.000 Domainoid score I10005
eggNOG 1 0.900 - - E2759_KOG4443
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H18102
Inparanoid 1 1.050 139 1.000 Inparanoid score I4423
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1397649at2759
OrthoFinder 1 1.000 - - FOG0005809
OrthoInspector 1 1.000 - - otm44541
orthoMCL 1 0.900 - - OOG6_105977
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4784
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.660

Return to query results.
Submit another query.