DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31111 and Kmt2c

DIOPT Version :9

Sequence 1:NP_733074.1 Gene:CG31111 / 318595 FlyBaseID:FBgn0051111 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_006535745.1 Gene:Kmt2c / 231051 MGIID:2444959 Length:4976 Species:Mus musculus


Alignment Length:154 Identity:36/154 - (23%)
Similarity:69/154 - (44%) Gaps:12/154 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 TIVRKKKPMFPMNLNNVLLHSLGEIISVNPN-FHTESWIYPVGYVATRIYAHPKDPRKKCVFTCK 162
            :||::.:......:.:::.|::|:::..... ||:...::||||.|:|:|...:...::|.:.|.
Mouse  4602 SIVQRGERDHTFRVGSLIFHTIGQLLPQQMQAFHSPKALFPVGYEASRLYWSTRYANRRCRYLCS 4666

  Fly   163 ILNNAGIPQF--QIIPDNDLDGVFFGESANMCHMELLNSIQRSPCVKIK------IPFDVQGEVF 219
            |....|.|.|  :|:.....|.|....|......::|..:   .||:.|      .|..::||..
Mouse  4667 IEEKDGRPVFVIRIVEQGHEDLVLSDSSPKDVWDKILEPV---ACVRKKSEMLQLFPAYLKGEDL 4728

  Fly   220 FGLSNQKTQSLLMMDPAFHQCTNF 243
            |||:......:....|....|.|:
Mouse  4729 FGLTVSAVARIAESLPGVEACENY 4752

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31111NP_733074.1 FYRN 114..163 CDD:283589 13/49 (27%)
FYRC 171..246 CDD:197781 18/81 (22%)
Kmt2cXP_006535745.1 PHD2_KMT2C 390..435 CDD:277069
PHD3_KMT2C 466..517 CDD:276986
PHD4_KMT2C 947..1003 CDD:277071
PHD5_KMT2C_like 1004..1050 CDD:276988
RanBP2-type Zn finger 1079..1101 CDD:275375
PHD6_KMT2C 1081..1131 CDD:277073
HMG-box 1661..1712 CDD:381793
Tma16 1699..>1782 CDD:371407
PHA03247 <1880..2370 CDD:223021
PHA03247 <2146..2753 CDD:223021
PKK 3189..3275 CDD:372134
Atrophin-1 3288..>3590 CDD:367360
ePHD2_KMT2C 4467..4571 CDD:277167
FYRN 4616..4667 CDD:368685 13/50 (26%)
FYRC 4673..4757 CDD:368686 19/83 (23%)
SET_KMT2C_2D 4823..4975 CDD:380948
ePHD1_KMT2C 247..330 CDD:277166
PHD1_KMT2C_like 343..388 CDD:276984
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.