DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk22 and ASIC5

DIOPT Version :9

Sequence 1:NP_733051.2 Gene:ppk22 / 318593 FlyBaseID:FBgn0051105 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_059115.1 Gene:ASIC5 / 51802 HGNCID:17537 Length:505 Species:Homo sapiens


Alignment Length:525 Identity:117/525 - (22%)
Similarity:203/525 - (38%) Gaps:132/525 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VRNISLQGYNKLLSPDLTLGQRLIWLLVHMATTVSLIVVLSLTWEQFVAQ----SFVTNLKDPLF 105
            :.|| :|..:|:        :|::||:|.:. :|||:     ||:.::..    ::.|.....:.
Human    50 IHNI-VQNRSKI--------RRVLWLVVVLG-SVSLV-----TWQIYIRLLNYFTWPTTTSIEVQ 99

  Fly   106 PVENVPFPAVSICPNNRISRQAVIQYA---------------EELRLNSPVIRPVEYFLERLRFF 155
            .||.:.||||:.|..||....||.::.               :|:..||...|....|....:.|
Human   100 YVEKMEFPAVTFCNLNRFQTDAVAKFGVIFFLWHIVSKVLHLQEITANSTGSREATDFAASHQNF 164

  Fly   156 R--EFYTHVGVVVDTDDFITFQTFLDVFGTWNNETFFDTRRIMKMLTPRCQGFVLKCTVANVEVP 218
            .  ||..:.|..:                  ||.|..|           |:.|         ..|
Human   165 SIVEFIRNKGFYL------------------NNSTLLD-----------CEFF---------GKP 191

  Fly   219 CFSKDAFQDSLTMYGPCCTFNMENKLKKRHFKNRLASSELGLKVVLN---DSHVDYFAPILNTNG 280
            |..|| |....|.||.|.|||....|:.   |.:::.|..||.::.|   ::..|..|......|
Human   192 CSPKD-FAHVFTEYGNCFTFNHGETLQA---KRKVSVSGRGLSLLFNVNQEAFTDNPALGFVDAG 252

  Fly   281 YIVMIHNAENYASVYSSNVLEMFPGQGEDSYIAVCARVVDTDDSLKSFSPFSRRCYFEY---EAQ 342
            .|.:||         |...:..|.|.|..|.:.:.|||  |...:|:       .:.||   |..
Human   253 IIFVIH---------SPKKVPQFDGLGLLSPVGMHARV--TIRQVKT-------VHQEYPWGECN 299

  Fly   343 NPIHEQLMNTYSLSYTFPNCITRCRIRSIIALCRCLPFQMPLQLVENLDGVVYCTL-GHVSCLNQ 406
            ..|..|..::||.|    .|:..|:.:.|...|.|:||.:|...:|       |.| .:.||::.
Human   300 PNIKLQNFSSYSTS----GCLKECKAQHIKKQCGCVPFLLPGYGIE-------CDLQKYFSCVSP 353

  Fly   407 YI--FKWRNILTERHIVNGLEREIEEALYCPQCLPSCRDVQY--EVSMSALPIDNYLATLKLDEN 467
            .:  .:::::.|             ...:...|..||.:::|  .:|.|:.|....|..|....|
Human   354 VLDHIEFKDLCT-------------VGTHNSSCPVSCEEIEYPATISYSSFPSQKALKYLSKKLN 405

  Fly   468 NETEF-GTDISVLRVYFGDPHAQYYIRLLNNTWFEVFSTIGNIMSIFVGFSMVAIFEILFFVTKY 531
            ...:: ..::..:.:.:.|.:.:...:....:..|:.:.:|..:.:|.|.|::.|.||:.::...
Human   406 QSRKYIRENLVKIEINYSDLNYKITQQQKAVSVSELLADLGGQLGLFCGASLITIIEIIEYLFTN 470

  Fly   532 IYKGC 536
            .|..|
Human   471 FYWIC 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk22NP_733051.2 ASC 46..527 CDD:279230 115/513 (22%)
ASIC5NP_059115.1 ASC 41..466 CDD:279230 115/514 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7254
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X60
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.