DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk22 and ASIC1

DIOPT Version :9

Sequence 1:NP_733051.2 Gene:ppk22 / 318593 FlyBaseID:FBgn0051105 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_064423.2 Gene:ASIC1 / 41 HGNCID:100 Length:574 Species:Homo sapiens


Alignment Length:595 Identity:120/595 - (20%)
Similarity:202/595 - (33%) Gaps:173/595 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KESLGSAFCLDMADLVRNISLQGYNKLLSPDLTLGQRLIWLLVHMATTVSLIVVLSLTWEQFVAQ 94
            :|.:|....:.:.....:.:|.|...:.|.:....:|.:|.|..:.:...|:.|.:...:.:...
Human     7 EEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCVCTERVQYYFHY 71

  Fly    95 SFVTNLKDPLFPVENVPFPAVSICPNN-----RISRQAVIQYAEELRL--NSPVIRPVEYFLERL 152
            ..||.|.:  .....:.||||::|..|     ::|:..:....|.|.|  |...|...:...|: 
Human    72 HHVTKLDE--VAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNNRYEIPDTQMADEK- 133

  Fly   153 RFFREFYTHVGVVVDTDDFITFQTFLDVFGTWNNETFFDT--RRIMKMLTPRCQGFVLKCTVANV 215
                    .:.::.|..:|.:|:.     ..:|...|:|.  ..|..||        |.|.... 
Human   134 --------QLEILQDKANFRSFKP-----KPFNMREFYDRAGHDIRDML--------LSCHFRG- 176

  Fly   216 EVPCFSKDAFQDSLTMYGPCCTFNMENKLKKRHFKNRLASSELGLKVVLNDSHVDYFAPILNTN- 279
            || |.::| |:...|.||.|.|||.....:.| .|.....:..||:::| |...|.:.|:.... 
Human   177 EV-CSAED-FKVVFTRYGKCYTFNSGRDGRPR-LKTMKGGTGNGLEIML-DIQQDEYLPVWGETD 237

  Fly   280 ------GYIVMIHNA-----------------ENYASVYSSNVLEMFPGQGEDSYIAVCARVVDT 321
                  |..|.||:.                 :.:.:.....::.:.|..|      .| :.|..
Human   238 ETSFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWG------TC-KAVTM 295

  Fly   322 DDSLKSFSPFSRRCYFEYEAQNPIHEQLMNTYSLSYTFPNCITRCRIRSIIALCRCLPFQMPLQL 386
            |..|..|.                          ||:...|...|..|.::..|.|....||   
Human   296 DSDLDFFD--------------------------SYSITACRIDCETRYLVENCNCRMVHMP--- 331

  Fly   387 VENLDGVVYCT-LGHVSCLNQYIFKWRNILTERHIVNGLEREIEEALYCPQCLPSCRDVQY--EV 448
                ....||| ..:..|.:..:    :.|.|:      ::|     || .|...|...:|  |:
Human   332 ----GDAPYCTPEQYKECADPAL----DFLVEK------DQE-----YC-VCEMPCNLTRYGKEL 376

  Fly   449 SMSALPID---NYLATLKLDENNETEFGTDISVLRVYF--------------------------- 483
            ||..:|..   .|||  |....:|...|.:|.||.::|                           
Human   377 SMVKIPSKASAKYLA--KKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEIAGLLGELLMTP 439

  Fly   484 ------GDPHAQYYIR----LLNNTW------FE---VFSTIGNIMSIFVGFSMVAIFEILFFVT 529
                  |...|.|:.:    ||::..      |.   ....||..|.:|:|.|::.:.|:..:..
Human   440 VPFSCHGHGVAPYHPKAGCSLLSHEGPPPQRPFPKPCCLGDIGGQMGLFIGASILTVLELFDYAY 504

  Fly   530 KYI-YKGCNR 538
            :.| :|.|.|
Human   505 EVIKHKLCRR 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk22NP_733051.2 ASC 46..527 CDD:279230 114/565 (20%)
ASIC1NP_064423.2 ENaC 19..556 CDD:273304 118/583 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152096
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X60
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.