DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk22 and ASIC2

DIOPT Version :9

Sequence 1:NP_733051.2 Gene:ppk22 / 318593 FlyBaseID:FBgn0051105 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_899233.1 Gene:ASIC2 / 40 HGNCID:99 Length:563 Species:Homo sapiens


Alignment Length:528 Identity:116/528 - (21%)
Similarity:192/528 - (36%) Gaps:133/528 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 QRLIWLLVHMATTVSLIVVLS----LTWEQFVAQSFVTNLKDPLFPVENVPFPAVSICPNN---- 121
            :|.:|:|. ..|:..|::..|    |.|..|.:.:.|.....     ..:|||||::|.||    
Human    85 RRALWVLA-FCTSFGLLLSWSSNRLLYWLSFPSHTRVHREWS-----RQLPFPAVTVCNNNPLRF 143

  Fly   122 -RISRQAVIQYAEE---LRLNSPVIRPVEYFL-----ERLRFFREFYTHVGVVVDTDDFITFQTF 177
             |:|: ..:.||..   |.|.:...||:...|     .|.::||:             ...|:.|
Human   144 PRLSK-GDLYYAGHWLGLLLPNRTARPLVSELLRGDEPRRQWFRK-------------LADFRLF 194

  Fly   178 LDVFGTWNNETFFD--TRRIMKMLTPRCQGFVLKCTVANVEVPCFSKDAFQDSLTMYGPCCTFNM 240
            |.       ...|:  :...|..|..:.:..:|.|....   .......|....|.||.|..||.
Human   195 LP-------PRHFEGISAAFMDRLGHQLEDMLLSCKYRG---ELCGPHNFSSVFTKYGKCYMFNS 249

  Fly   241 --ENKLKKRHFKNRLASSELGLKVVLNDSHVDYFAPILNTNGYIVMIHNAENYASVYSSNVLEMF 303
              :.|......|....:   ||:::| |...|.:.||.           .|...:.:.:.|....
Human   250 GEDGKPLLTTVKGGTGN---GLEIML-DIQQDEYLPIW-----------GETEETTFEAGVKVQI 299

  Fly   304 PGQGEDSYIAVCA--------RVVDTDDSLKSFSPFSRRCYFEYEAQNPIHEQLMNTYSLSYTFP 360
            ..|.|..:|....        ..|.|.:...::.|            .|..|...:...|.: ||
Human   300 HSQSEPPFIQELGFGVAPGFQTFVATQEQRLTYLP------------PPWGECRSSEMGLDF-FP 351

  Fly   361 -NCITRCRI----RSIIALCRCLPFQMPLQLVENLDGVVYCT-LGHVSCLNQYIFKWRNILTERH 419
             ..||.|||    |.|:..|.|....||       ....:|| ..|..|....:    .:|.|: 
Human   352 VYSITACRIDCETRYIVENCNCRMVHMP-------GDAPFCTPEQHKECAEPAL----GLLAEK- 404

  Fly   420 IVNGLEREIEEALYCPQCLPSCRDVQYEVSMSALPIDNYLATLKLDEN-NETE--FGTDISVLRV 481
                      ::.|| .|...|...:|...:|.:.|.:..:...|::. |::|  ...:|.||.:
Human   405 ----------DSNYC-LCRTPCNLTRYNKELSMVKIPSKTSAKYLEKKFNKSEKYISENILVLDI 458

  Fly   482 YFGDPHAQYYIRLLNNTWFEVFSTIGNI---MSIFVGFSMVAIFEILFFVTKYIYKGCNRMVEQN 543
            :|   .|..|..:.....:||.:.:|:|   |.:|:|.|::.|.|:.    .|||:    ::::.
Human   459 FF---EALNYETIEQKKAYEVAALLGDIGGQMGLFIGASILTILELF----DYIYE----LIKEK 512

  Fly   544 IMDRKAKE 551
            ::|...||
Human   513 LLDLLGKE 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk22NP_733051.2 ASC 46..527 CDD:279230 110/502 (22%)
ASIC2NP_899233.1 ENaC 64..547 CDD:273304 116/528 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152100
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X60
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.