DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk22 and ppk27

DIOPT Version :9

Sequence 1:NP_733051.2 Gene:ppk22 / 318593 FlyBaseID:FBgn0051105 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_647826.2 Gene:ppk27 / 38440 FlyBaseID:FBgn0035458 Length:422 Species:Drosophila melanogaster


Alignment Length:507 Identity:112/507 - (22%)
Similarity:204/507 - (40%) Gaps:104/507 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SAFCLDMADLVRNISLQGYNKLLSPDLTLGQRLIW-LLVHMATTVSLIVVLSLTWEQFVAQSFVT 98
            :||...:.:..|..||.|:..|........||:.| |.:......:...|.|:..| |::.|.:.
  Fly     6 TAFNKTVVEYFRKTSLNGFGLLYFIRKRRIQRIFWFLFISFGILFASYAVFSMVLE-FLSYSTIA 69

  Fly    99 NLKDPLFPVENVPFPAVSICPNNRISRQAVIQYAEELRLNSPVIRPVEYFLERLRFFREFYTHVG 163
            :|.:.....:.:.||.:.||...:.|.:.::..|.:  |.|...:.::|:|.:|.....::..:.
  Fly    70 DLSELKVLEDEIHFPELKICSGYKFSYRNMLASAHD--LVSSQNKSLDYWLNKLSLLSGYFDALS 132

  Fly   164 VVVDTDDFITFQTFLDVFGTWNNETFFDTRRIMKMLTPRCQGFVLKCTVANVEVPC---FSKDAF 225
            |..:..|  ...:.||:    .|.:.|     :..|||.|:..:|||.:.|:...|   |:..|:
  Fly   133 VKAENVD--DLNSLLDI----KNISSF-----LLALTPACESLILKCKLNNIPANCLKLFTLKAY 186

  Fly   226 QDSLTMYGPCCTFNMENKLKKRHFKNRLASSELGLKVVLNDSHVDYFAPILNTNGYIVMIHNAEN 290
            .|     |.||.           .:|...:.||.|  .::.|.:|.:....|..|:.:.:.:.:.
  Fly   187 ND-----GNCCV-----------LRNSNLTGELTL--FMDSSQIDEYPLNGNLPGFSLHVPSWQG 233

  Fly   291 YASVYSSNVLEMFPGQGEDSYIAVCARVVDTDDSLKSFSPFSRRCYFEYEAQNPIHEQLMNTYSL 355
            ..|:          ..||.:.:.:....:..:..|..::...|.|||..|.::.           
  Fly   234 RVSI----------NPGEMAAVEIEVMELQGNSQLNEYAVEKRACYFSQEGESR----------- 277

  Fly   356 SYTFPNCITRCRIRSIIALCRCLPFQMPLQLVENLDGVVYCTLGHVSCLNQYIFKWRNILTERHI 420
                ..|:..|||::.:..|:|:|:  |.:......|  ||||.::.||.         |.||: 
  Fly   278 ----EKCLHECRIKATLINCQCVPY--PFEFRTQKFG--YCTLENIRCLQ---------LVERN- 324

  Fly   421 VNGLEREIEEALYCPQCLPSCRDVQYEVSMSALPIDNYLATLKLDENNETEFGTDISVLRVYFGD 485
                    .....||||||.|..:.|.::...|   .:|...:             |.|...|..
  Fly   325 --------WSPAQCPQCLPLCNQLFYRLNKQIL---GHLHPWR-------------SELNFKFKT 365

  Fly   486 PHAQYYIRLLNNTWFEVFSTIGNIMSIFVGFSMVAIFEILFFV-----TKYI 532
            ||.|.|...:...|:::.|.:|.::.|.:|.|.::.||:::|:     |.|:
  Fly   366 PHRQRYKTNILYHWYQMLSNVGGVLGICIGCSFISGFELIYFLVFRLWTNYL 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk22NP_733051.2 ASC 46..527 CDD:279230 107/484 (22%)
ppk27NP_647826.2 ASC 15..407 CDD:279230 107/486 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 1 1.000 - - FOG0012689
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.