powered by:
Protein Alignment ppk22 and Y57G11C.44
DIOPT Version :9
Sequence 1: | NP_733051.2 |
Gene: | ppk22 / 318593 |
FlyBaseID: | FBgn0051105 |
Length: | 561 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001255829.1 |
Gene: | Y57G11C.44 / 3565567 |
WormBaseID: | WBGene00013333 |
Length: | 155 |
Species: | Caenorhabditis elegans |
Alignment Length: | 62 |
Identity: | 15/62 - (24%) |
Similarity: | 32/62 - (51%) |
Gaps: | 3/62 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 67 LIWLLVHMATTVSLIVVLSLTWEQFVAQSFVTNLKDPLFPVENVPFPAVSICPNNRISRQAV 128
|:|..:.:.:.|..:.::::|..|:.:...:.||. :..||: .||:::.|..|.....||
Worm 79 LLWTTLLIISAVLFVYLITVTVRQYFSFQKLVNLN--IGMVES-NFPSITFCNTNPYKLSAV 137
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
ppk22 | NP_733051.2 |
ASC |
46..527 |
CDD:279230 |
15/62 (24%) |
Y57G11C.44 | NP_001255829.1 |
ASC |
60..>142 |
CDD:279230 |
15/62 (24%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160162280 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.