DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk22 and ppk23

DIOPT Version :9

Sequence 1:NP_733051.2 Gene:ppk22 / 318593 FlyBaseID:FBgn0051105 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_001097011.1 Gene:ppk23 / 32731 FlyBaseID:FBgn0030844 Length:591 Species:Drosophila melanogaster


Alignment Length:563 Identity:124/563 - (22%)
Similarity:218/563 - (38%) Gaps:135/563 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DLVRNISLQGYNKLLSPDLTLGQRLIWL-LVHMATTVSLIVVLSLTWEQFVAQSFVTNLKDPLFP 106
            :..:|.:|.|...:......:|::.:|. ...:....:|::::|| ||:|.....:|.| |..|.
  Fly    33 EFFQNSTLHGVRYIAESGRPIGEKFMWFCFTSIGAVTALVIIMSL-WEKFQTNPTITGL-DTDFH 95

  Fly   107 VENVPFPAVSICPNNRISR--------QAVIQYAE-ELRLNSPVIRPVEYFLERLRFFREFYTHV 162
            .:||.||...:||......        ..:..|.| :.::.:|.:|    .|..|.|  |.....
  Fly    96 NQNVVFPTTVVCPEAAFDHDKTYEKVYNTLANYDEAQAQMYTPFLR----ILTSLNF--ENVRDA 154

  Fly   163 GVVVDTDDFITFQTFLD--VFGTWNNETFFDTRRIMKMLTPRCQGFVLKCTVANVEVPCFSKDAF 225
            .|:..:..    |..||  ....|..|...|           |:...:.|...:.::||.  |.|
  Fly   155 KVLSQSIP----QNLLDAHTIREWAFEGHID-----------CKNVFVSCKYRDEDIPCC--DHF 202

  Fly   226 QDSLTMYGPCCTFNMENKLKKRHFKNRLASS----------ELGLKVVLNDSHVDYFAPILNTNG 280
            :...|.:|.|..||       ..||:.....          |...|..|      :|.|  |:..
  Fly   203 EPIYTEHGFCYAFN-------SRFKSTPTEDVKTGAPHDLYETDKKWAL------FFIP--NSTS 252

  Fly   281 YIVMIHNAENYASVYSSNVLEMFPGQGEDSYIAVCARVVDTDDSLKSFSPFSRRCYFEYEAQNPI 345
            .|.:..|.|.:.|.:::.:....|...|   :.:..:...|.|..:..|...|:|.|..|.:   
  Fly   253 RIFIFSNEEYFGSDFNAQIDWSEPQLVE---VRISKKNTYTTDDARQLSIGQRKCIFSDEVK--- 311

  Fly   346 HEQLMNTYSLSYTFPNCITRCRIRSIIALCRC-LPFQMPLQ-------LVENL------------ 390
                :|.:..:|||.:|:.:||:...|.||:| .||..|::       :..||            
  Fly   312 ----LNYFPDAYTFSSCMKQCRMNKAIKLCKCNPPFYKPIRELSCVINIFTNLIAYILLLYLTPK 372

  Fly   391 DGVVYCTLGHVSCLNQYIFKWRNILTERHIVNGLEREIEEALYCPQCLPSCRDVQYEVSMSALPI 455
            ..|..|::....||:::         :.:|.|     |::   |.||..||       |.:...|
  Fly   373 ANVPMCSIKDFDCLDEF---------KSNITN-----IKD---CLQCELSC-------SKTVFNI 413

  Fly   456 DNYLATLKLDENNETEFGTDISVLRVYFGDPHAQYYIRLLNNTWFEVFSTIGNIMSIFVGFSMVA 520
            |.   .:|:.:..|:     :.||..:...|..:|...:|.. |.::..:.|.|.|:|:|||:::
  Fly   414 DK---LIKMSDRPES-----LGVLVEFLTWPIIRYKREVLFG-WVDLLVSFGGIASLFLGFSLLS 469

  Fly   521 IFEILFFVTK----YIYKGCNRM----VEQNIMDRKAKELETK 555
            ..||:::.|.    .:||  ||.    :|:.|......:::.|
  Fly   470 GVEIIYYFTLRACCMVYK--NRQELYEIEEKIRQEPPPKIDLK 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk22NP_733051.2 ASC 46..527 CDD:279230 116/522 (22%)
ppk23NP_001097011.1 ASC 34..476 CDD:279230 116/524 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.