DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk22 and del-5

DIOPT Version :9

Sequence 1:NP_733051.2 Gene:ppk22 / 318593 FlyBaseID:FBgn0051105 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_509838.2 Gene:del-5 / 186631 WormBaseID:WBGene00010334 Length:526 Species:Caenorhabditis elegans


Alignment Length:322 Identity:67/322 - (20%)
Similarity:115/322 - (35%) Gaps:107/322 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 YIAVCARVVDTDDSLKSFSPFSRRCYFEYEAQNPI----HEQL----------------MNTYSL 355
            ||.||..::.|..:..||...:..  ..:.|:|.|    .:||                ::.|.:
 Worm   101 YIMVCGTMIKTYSTQPSFMRINET--KSHRAENNIELCSEKQLTCNEILKENKQMTCKEVDAYCV 163

  Fly   356 SYTFPNCITRCRIRSIIALCRCLPFQ-------------------MPLQLVENLDGVVYCTLGHV 401
            |..| :..|:.|::.     :.|.|:                   :.|:|:: :|.:   .||..
 Worm   164 SIRF-STKTKIRLKK-----KGLYFKHGTEEDVHYLSSKPHTHHMIRLKLIQ-IDRL---NLGRA 218

  Fly   402 SCLNQYIFKWRNIL--------TERHIVN-------GLEREIEEALYCPQCLPSCRDVQYEVSMS 451
            .|..    .||.|.        ..|:.:|       .|.|::|...|...|.|||.:::|:||.|
 Worm   219 PCTT----NWREITWIEKDSIPDYRYSLNMCENIRFELTRKVEYLQYDFPCYPSCSEIKYQVSKS 279

  Fly   452 ALPIDNYLATLKLDENNETEFGTDISVLRVYFGDPHAQYYIRLLNNTWFEVFSTIGNIMSIFVGF 516
                       ||..::::...| .|||      |...........|..::...:|...|:|:|.
 Worm   280 -----------KLRHSSDSVVIT-FSVL------PTITLMQETRKTTLIDILCYLGGASSLFMGC 326

  Fly   517 SMVAIFEILFFVTKYIYKGC-------------NRMVEQNIMDRKAK------ELETKKLYI 559
            |.|.:.|:..|:.|.:.|..             |..:|....|.:.|      :.||.:.|:
 Worm   327 SCVTLMEMFVFLFKLVAKSACSQEVPEPDDSFYNDKIEFEYSDHRNKRRYAIFDRETMEKYL 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk22NP_733051.2 ASC 46..527 CDD:279230 57/269 (21%)
del-5NP_509838.2 ASC 66..337 CDD:295594 57/269 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.