DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk22 and deg-1

DIOPT Version :9

Sequence 1:NP_733051.2 Gene:ppk22 / 318593 FlyBaseID:FBgn0051105 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_001360706.1 Gene:deg-1 / 181035 WormBaseID:WBGene00000950 Length:844 Species:Caenorhabditis elegans


Alignment Length:374 Identity:68/374 - (18%)
Similarity:124/374 - (33%) Gaps:135/374 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 YGPCCTFNMENKLKKRHFKNRLASSELGLKVVLNDSHVDYFA-----------------PILNTN 279
            :|.|.|||.:   ...::.:..|....|::|:|..:..||.:                 |..:|.
 Worm   526 FGNCFTFNYD---VNNNYTSSRAGPMYGIRVLLFVNTSDYMSTSESSGVRLAIHPPTEYPFPDTF 587

  Fly   280 GYIVMIHNAENYASVYSSNVLEMFPG-QGEDSYIAVCA---RVVDTDDSLKSFSPFSRRCYFEYE 340
            ||...:..|.::.  ....|::..|. .||      |.   :|||.:           ..|..|:
 Worm   588 GYSAPVGFASSFG--IKKKVMQRLPAPYGE------CVETKKVVDRN-----------YIYAGYD 633

  Fly   341 AQNPIHEQLMNTYSLSYTFPNCITRCRIRSIIALCRCLPFQMPLQLVENLDGVVYCTLGHV---S 402
                            |....|...|....:|..|.|...:.|:.     :|..:|:..:.   :
 Worm   634 ----------------YHPEGCHRSCFQNGLIDDCSCGDPRFPVP-----EGYRHCSAFNATART 677

  Fly   403 CLNQYIFKWRNILTERHIVNGLEREIEEALYCPQCLPSCRDVQYEVSMSALPIDNYLATL-KLDE 466
            ||.:.|   .::....||...:::.:        |..||.::.:||:.|.....:....| ..|.
 Worm   678 CLEKNI---GSVGDFHHITQKMDKCV--------CKQSCEEIIHEVTFSCSKWPSGATDLGDCDG 731

  Fly   467 NNETEFGTDISVLRVYFGDPHAQYYIRLLNNTWFEVF---------------------STIGNIM 510
            ..|:|.               .|||  .||....|||                     :..|..:
 Worm   732 MTESEC---------------EQYY--RLNAAMIEVFYEQLNYELLQESEAYGLVNLIADFGGHL 779

  Fly   511 SIFVGFSMVAIFEI---------LFFVTKYIYKGCNRMVEQNIMDRKAK 550
            .:::|||::.:.|:         |||.:::         |:.::.:..|
 Worm   780 GLWLGFSVITVMEVCVLLVDMISLFFKSRH---------EEKLLRQSTK 819

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk22NP_733051.2 ASC 46..527 CDD:279230 64/349 (18%)
deg-1NP_001360706.1 deg-1 58..796 CDD:273309 63/340 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X60
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.