DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk22 and egas-1

DIOPT Version :9

Sequence 1:NP_733051.2 Gene:ppk22 / 318593 FlyBaseID:FBgn0051105 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_001359624.1 Gene:egas-1 / 180219 WormBaseID:WBGene00013486 Length:922 Species:Caenorhabditis elegans


Alignment Length:370 Identity:76/370 - (20%)
Similarity:119/370 - (32%) Gaps:145/370 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 FSKDAFQDSL------------TMYGPCCTFNMENKLKKRHFKNRLASS--ELGLKVVLNDSHVD 270
            |:..||:|..            .:.|.|.|||.    :.|:|..||.||  ..|::..:. :..|
 Worm   624 FNWIAFEDQRLDLNRDIHKWNDVVLGNCFTFNH----RDRNFTYRLRSSGRHGGIQAFMK-TRQD 683

  Fly   271 YFAPILNTNGYIVMIHNAENYASVYSSNVLEMFPGQGEDSYIAVCARVVDTDDSLKSFSPFSRRC 335
            .:||..:|....|.|||.::|  |:|.:|                                    
 Worm   684 EYAPWYDTAAINVFIHNRDDY--VFSESV------------------------------------ 710

  Fly   336 YFEYEAQNPIHEQLMNTYSLSYT--------------------FP------NCITRCRIRSIIAL 374
              .|.|| |..:..||.:...||                    :|      .|:..|....:...
 Worm   711 --RYNAQ-PNAQSTMNIFMTRYTRLGGRYGKCVKKPSEVKNYYYPGAYTTDGCLRTCYQDRMKQE 772

  Fly   375 CRCLPFQMPLQLVENLDGVVYCTLGHVSCLNQYI------FKWRNILTERHIVNGLEREIEEALY 433
            |.|:..:.| |...|   |..|.|...||:....      .||.:.:                  
 Worm   773 CNCMDPRYP-QAPGN---VTSCQLSERSCVTVASEAAGDPSKWWDCV------------------ 815

  Fly   434 CPQCLPSCRDVQYEVSMSA-----LPIDNYLATLKLDENNETEFGTDISVLRVYFGD-------- 485
            ||  || |.:.:|.|:.|.     |||             .....:|:|..:.::.|        
 Worm   816 CP--LP-CSNQEYSVTWSKANFVNLPI-------------ICGKSSDVSTCKAHYIDQLMVSIVL 864

  Fly   486 PHAQYYIRLLNNTW-FEVF-STIGNIMSIFVGFSMVAIFEILFFV 528
            |...:.|...|... |..| |.:|..:.:.:|.::|...|::|.:
 Worm   865 PQLDFKIYAENPAMDFNKFLSQLGGQLGVLMGINLVTFIEVVFLL 909

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk22NP_733051.2 ASC 46..527 CDD:279230 75/367 (20%)
egas-1NP_001359624.1 deg-1 <595..908 CDD:273309 75/367 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.