DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31091 and AT1G73920

DIOPT Version :10

Sequence 1:NP_733127.1 Gene:CG31091 / 318591 FlyBaseID:FBgn0051091 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_565075.1 Gene:AT1G73920 / 843729 AraportID:AT1G73920 Length:704 Species:Arabidopsis thaliana


Alignment Length:85 Identity:22/85 - (25%)
Similarity:35/85 - (41%) Gaps:13/85 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 ADPNQQPNKWAVLAGTVAGSYLVLYL-FDSLLIVAFAIL-LPFSLTFVH----------ASLRLR 156
            |.|..:|:|....|..:..|:..:.. .||..:....|| .||||:...          :.|.|:
plant   299 ASPESKPHKAEEAAVDLDESFSQMTPDIDSAGMGTLEILQTPFSLSCYESPANLPEDSGSHLELQ 363

  Fly   157 NIKNKITNAVEIVGVKQSPM 176
            :.|.. ..|.|:..|::.||
plant   364 SNKAN-AEACEVFEVRRDPM 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31091NP_733127.1 PLN02872 42..416 CDD:215470 22/85 (26%)
AT1G73920NP_565075.1 PLN02872 296..>440 CDD:215470 22/85 (26%)
alpha/beta hydrolases 332..583 CDD:473884 14/52 (27%)

Return to query results.
Submit another query.