DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31091 and AT1G73750

DIOPT Version :9

Sequence 1:NP_001247307.1 Gene:CG31091 / 318591 FlyBaseID:FBgn0051091 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001323220.1 Gene:AT1G73750 / 843710 AraportID:AT1G73750 Length:468 Species:Arabidopsis thaliana


Alignment Length:193 Identity:38/193 - (19%)
Similarity:73/193 - (37%) Gaps:58/193 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ERHYVTTEDG-YIISLFRIPYSHNIQNQQEKRPIAFIQHGLFASSDFWPSLGPDDGLPFLLSDAG 130
            |.|||...:. :.::|:|  |..:.:..:...|:..:. |:..::..: .|.|:......:|.:|
plant    61 ELHYVPVPNSDWRVALWR--YLPSPKAPKRNHPLLLLS-GIGTNAVTY-DLSPECSFARSMSGSG 121

  Fly   131 YDVWLGNARG----------NRYSKNHTSRLTSH------------------------------- 154
            :|.|:...||          |....|:..|:.|:                               
plant   122 FDTWILELRGAGLSSLSVDTNLGKGNNQQRIVSNLLENFISVSERLENVLDGGSKILGMQDRLSK 186

  Fly   155 --PDFWR-------FSWHEIGYF--DIAAAIDYTLSTENGQDQKGIHYIGHSQGTTVMFVLLS 206
              .||.:       ::|....|.  |:.:|:||..:....:|.| :..:|||.|..:::.|||
plant   187 RAGDFKQRFELIPHYNWDFDNYLEEDVPSAMDYVRTQTKSKDGK-LLAVGHSMGGILLYALLS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31091NP_001247307.1 PLN02872 42..416 CDD:215470 38/193 (20%)
Abhydro_lipase 55..117 CDD:282003 9/50 (18%)
Abhydrolase_5 104..>239 CDD:289465 30/155 (19%)
AT1G73750NP_001323220.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.