DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31091 and AT1G15060

DIOPT Version :9

Sequence 1:NP_001247307.1 Gene:CG31091 / 318591 FlyBaseID:FBgn0051091 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001319006.1 Gene:AT1G15060 / 838071 AraportID:AT1G15060 Length:578 Species:Arabidopsis thaliana


Alignment Length:278 Identity:56/278 - (20%)
Similarity:96/278 - (34%) Gaps:87/278 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 RFSWHEIGYF--DIAAAIDYTLSTENGQDQKGIHYIGHSQGTTVMFVLLS--------------- 206
            ::.|....|.  |:.|||:|..:....:|.| :..||||.|..:::.:||               
plant   326 KYDWDFDHYLEEDVPAAIEYVRAQSKPKDGK-LFAIGHSMGGILLYAMLSRCAFEGREPSVAAVA 389

  Fly   207 ---SRPEYNDKIKTAHMLAPVAFMDHMDDVMV-------------NTLSPYLGFNNIYSTLFCSQ 255
               |..:|........:|.|:|.......|.|             :|..||     :.|.|    
plant   390 TLASSVDYTTSNSALKLLIPLANPAEALSVPVVPLGALLAAAFPLSTRPPY-----VLSWL---- 445

  Fly   256 EFLPHNDFVLA--LMYSVCLPESIVYSFCSSSNETTTEEGRTNSTASALTSGVMPAGVSTDQILH 318
                 ||.:.:  :|:...|.:.::.:||:...:...:          ||:.....|:       
plant   446 -----NDLISSTDMMHPEMLEKLVLNNFCTIPAKLLIQ----------LTTAFREGGL------- 488

  Fly   319 YMQEHQSGHFRQFDFGTKKNMKVYGTEAPEDYPTELITAEMHLWYSDSDEMAAVEDVLRV-AETL 382
               ..:||.|...|...:.::.|.......|    ||...           |||||.::: .|.|
plant   489 ---RDRSGKFYYKDHLPRTSVPVLALAGDRD----LICPP-----------AAVEDTVKLFPENL 535

  Fly   383 PN-KVMHHMEDPLWDHMD 399
            .. |::...:.|.:.|.|
plant   536 VTYKLLGEPDGPHYAHYD 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31091NP_001247307.1 PLN02872 42..416 CDD:215470 56/278 (20%)
Abhydro_lipase 55..117 CDD:282003
Abhydrolase_5 104..>239 CDD:289465 24/112 (21%)
AT1G15060NP_001319006.1 Hydrolase_4 <330..545 CDD:403389 52/264 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.