DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31091 and LIPM

DIOPT Version :9

Sequence 1:NP_001247307.1 Gene:CG31091 / 318591 FlyBaseID:FBgn0051091 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_011538050.1 Gene:LIPM / 340654 HGNCID:23455 Length:430 Species:Homo sapiens


Alignment Length:402 Identity:125/402 - (31%)
Similarity:202/402 - (50%) Gaps:46/402 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NPDAHLSLTNGPDTIHFIEEHGYPVERHYVTTEDGYIISLFRIPYSHNIQNQQEKRPIAFIQHGL 106
            :|:|.::::      ..|:..|||.|.:.|.||||||:|:.|||.......:...||:..:||||
Human    42 DPEAFMNIS------EIIQHQGYPCEEYEVATEDGYILSVNRIPRGLVQPKKTGSRPVVLLQHGL 100

  Fly   107 FASSDFWPSLGPDDGLPFLLSDAGYDVWLGNARGNRYSKNHTSRLTSHPDFWRFSWHEIGYFDIA 171
            ...:..|.|..|::.|.|:|:|||:|||:||:|||.:|:.|.:......:||.||:.|:..||:.
Human   101 VGGASNWISNLPNNSLGFILADAGFDVWMGNSRGNAWSRKHKTLSIDQDEFWAFSYDEMARFDLP 165

  Fly   172 AAIDYTLSTENGQDQKGIHYIGHSQGTTVMFVLLSSRPEYNDKIKTAHMLAPVAFMDH------- 229
            |.|::.|. :.||::  |:|:|:|||||:.|:..|:.||...|||....|||:|.:.|       
Human   166 AVINFILQ-KTGQEK--IYYVGYSQGTTMGFIAFSTMPELAQKIKMYFALAPIATVKHAKSPGTK 227

  Fly   230 ---MDDVMVNTLSPYLGFNNIYSTLFCSQEFLPHNDFVLALMYSVCLPESIVYSFCS-------- 283
               :.|:|:             ..||..:|||....|:..|:..:| .:.|:...||        
Human   228 FLLLPDMMI-------------KGLFGKKEFLYQTRFLRQLVIYLC-GQVILDQICSNIMLLLGG 278

  Fly   284 --SSNETTTEEGRTNSTASALTSGVMPAGVSTDQILHYMQEHQSGHFRQFDFGTK-KNMKVYGTE 345
              ::|......|...|.||...:..: ||.|...|||:.|...||..|.||:|:: ||::.....
Human   279 FNTNNMNMNTHGLLQSRASVYAAHTL-AGTSVQNILHWSQAVNSGELRAFDWGSETKNLEKCNQP 342

  Fly   346 APEDYPTELITAEMHLWYSDSDEMAAVEDVLRVAETLPNKVMHHMEDPLWDHMDFALNWEVRQYI 410
            .|..|....:|....:|....|.::..|||..:...:.| :::|...|.|.|:||....:....:
Human   343 TPVRYRVRDMTVPTAMWTGGQDWLSNPEDVKMLLSEVTN-LIYHKNIPEWAHVDFIWGLDAPHRM 406

  Fly   411 NDPIVAILNEYE 422
            .:.|:.::.:.|
Human   407 YNEIIHLMQQEE 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31091NP_001247307.1 PLN02872 42..416 CDD:215470 124/394 (31%)
Abhydro_lipase 55..117 CDD:282003 24/61 (39%)
Abhydrolase_5 104..>239 CDD:289465 56/144 (39%)
LIPMXP_011538050.1 Abhydro_lipase 49..111 CDD:282003 24/67 (36%)
Abhydrolase_1 92..399 CDD:278959 104/325 (32%)
Abhydrolase_5 93..>231 CDD:289465 55/140 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141774
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55134
OrthoDB 1 1.010 - - D408561at33208
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.