DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31091 and abhd-11.1

DIOPT Version :9

Sequence 1:NP_001247307.1 Gene:CG31091 / 318591 FlyBaseID:FBgn0051091 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_492942.1 Gene:abhd-11.1 / 185192 WormBaseID:WBGene00009316 Length:297 Species:Caenorhabditis elegans


Alignment Length:233 Identity:49/233 - (21%)
Similarity:78/233 - (33%) Gaps:88/233 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 RIPYSHNIQ----------NQQEKRPIAFIQHGLFASSDFWPSLGPDDGLPFLLSDAGYDVWLGN 137
            |.|:|.:..          |.:.|.....:..|||.:.:.|..:|.|     |....|..|:   
 Worm    11 RFPHSDSTSSMMLANLTFGNMRSKGTPLILVPGLFGTKENWIQVGKD-----LSQRLGCMVF--- 67

  Fly   138 ARGNRYSKNHTSRLTSHPDFWRFSWHEIGYFDIAAAIDYTLSTEN------------GQDQKGIH 190
            |..||   ||                  |.|..||::.|....::            |:|:..:|
 Worm    68 AVENR---NH------------------GSFSKAASMTYEEMADDLVGFIDWVRKITGEDKVNLH 111

  Fly   191 YIGHSQGTTVMFVLLSSRPEYNDKIKTAHMLAPVAFMDHMDDVMVNTLSPYLGFNNIYSTLFCSQ 255
              |||.|...: ..|::.|||:.:||:               ::|..:|| ||:.          
 Worm   112 --GHSMGGKAV-TQLATTPEYSSRIKS---------------LIVEDMSP-LGYP---------- 147

  Fly   256 EFLPHNDFVLALMYSVCLPESIVYSFCSSSNETTTEEG 293
                    :....|..|:.:.|......|.:|...|.|
 Worm   148 --------LKRAEYLECIKQMIATDMNKSRSEVMAELG 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31091NP_001247307.1 PLN02872 42..416 CDD:215470 49/233 (21%)
Abhydro_lipase 55..117 CDD:282003 9/43 (21%)
Abhydrolase_5 104..>239 CDD:289465 33/146 (23%)
abhd-11.1NP_492942.1 PRK10673 36..287 CDD:182637 44/208 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.