DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-9 and SET6

DIOPT Version :10

Sequence 1:NP_572539.2 Gene:SmydA-9 / 31859 FlyBaseID:FBgn0030102 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_015160.1 Gene:SET6 / 855938 SGDID:S000006086 Length:373 Species:Saccharomyces cerevisiae


Alignment Length:83 Identity:24/83 - (28%)
Similarity:37/83 - (44%) Gaps:3/83 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 NDNQEFNYRALYPLFGVVNHDCIPNAYYTFEEKTNNMIVRAAVDIPEGFEVTTTYT-KLFTGNIA 262
            :|::|:....::|.....||.|.||  .|...|.|:|:.....||.:..::...|: .|....:.
Yeast   285 SDSREYFGYWVFPEASYFNHSCNPN--ITKYRKGNSMLFTMNRDIKKDEQICIDYSGVLDLPTVK 347

  Fly   263 RHLFLKMKKSFTCKCSRC 280
            |..||.....|.|.|.||
Yeast   348 RRAFLADSWFFDCACERC 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-9NP_572539.2 SET 26..>49 CDD:394802
SET_SMYD <183..280 CDD:380997 22/81 (27%)
SET6NP_015160.1 SET_SMYD <274..365 CDD:380997 22/81 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.