DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-9 and ATXR2

DIOPT Version :10

Sequence 1:NP_572539.2 Gene:SmydA-9 / 31859 FlyBaseID:FBgn0030102 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_188819.2 Gene:ATXR2 / 821736 AraportID:AT3G21820 Length:473 Species:Arabidopsis thaliana


Alignment Length:81 Identity:25/81 - (30%)
Similarity:39/81 - (48%) Gaps:15/81 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 ALYPLFGVVNHDCIPN--AYYTFEEKTNNMIVRAAVDIPEGFEVTTTYTKLFTGNIARHLFLKMK 270
            |.:||...:||.|.||  |:...|::....::.|...|.:..|||.:|       |...|..|.:
plant   393 AFFPLQSCMNHSCCPNAKAFKREEDRDGQAVIIALRRISKNEEVTISY-------IDEELPYKER 450

  Fly   271 KS------FTCKCSRC 280
            ::      |:||||:|
plant   451 QALLADYGFSCKCSKC 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-9NP_572539.2 SET 26..>49 CDD:394802
SET_SMYD <183..280 CDD:380997 24/79 (30%)
ATXR2NP_188819.2 zf-MYND <173..203 CDD:460312
SET_SMYD <380..466 CDD:380997 24/79 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.