DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-9 and AT1G26761

DIOPT Version :10

Sequence 1:NP_572539.2 Gene:SmydA-9 / 31859 FlyBaseID:FBgn0030102 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001117357.1 Gene:AT1G26761 / 6241260 AraportID:AT1G26761 Length:444 Species:Arabidopsis thaliana


Alignment Length:104 Identity:22/104 - (21%)
Similarity:37/104 - (35%) Gaps:31/104 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 KMKKSFTCKCSRCSDPTEKGAFISGLYCRDTNCT---GLVVPEITGLPHPNWNCLVCKQKSTHAQ 329
            |....||...:|||....:.|      .:|::.:   |||..  .|:...:|:            
plant    36 KRVSPFTLTITRCSTTKSREA------GQDSSISLKRGLVFD--LGVSKDSWH------------ 80

  Fly   330 MMKSQDFASGAINAKVNSNSLRTLVQY-----LNEKSDS 363
               |::..|..:...::.|..|..:.|     .|..|||
plant    81 ---SEEIGSPVVKRFLSDNEERWYMWYHGSSKQNPVSDS 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-9NP_572539.2 SET 26..>49 CDD:394802
SET_SMYD <183..280 CDD:380997 3/11 (27%)
AT1G26761NP_001117357.1 GH43_62_32_68_117_130 <99..>130 CDD:449341 6/18 (33%)
GH43_62_32_68_117_130 202..430 CDD:449341
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.