DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31077 and CG42397

DIOPT Version :9

Sequence 1:NP_733185.2 Gene:CG31077 / 318583 FlyBaseID:FBgn0051077 Length:988 Species:Drosophila melanogaster
Sequence 2:NP_001163428.1 Gene:CG42397 / 8673976 FlyBaseID:FBgn0259748 Length:178 Species:Drosophila melanogaster


Alignment Length:145 Identity:41/145 - (28%)
Similarity:61/145 - (42%) Gaps:17/145 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   846 DTGPPMTKPDESCIRDINGVCV---DPLAKCREGQHKLDPNNCAGYLKCQNGELIEELCPNGFYY 907
            ||...:|..:.:.:.|...|.|   .|...|.:....|...:|..|.:|..||.|.::||:|.|:
  Fly    26 DTNIKLTTDESTTVEDTTEVLVTTLPPPVLCADEDLFLPAPDCREYYQCLYGEGILKICPDGLYW 90

  Fly   908 DFLMKI-------CLVDRRGICVTNIQICDEGALEEDPH--DCAGYRQCIDGQVENLKCPFGTYF 963
            |..:.:       |..|:......:...|..| |...|:  ||..:.||:......|.||.|.|:
  Fly    91 DRELNVCAWDSQHCADDKNETTTPSTLNCASG-LPFLPYIPDCTKFIQCVYNIGFKLSCPSGLYW 154

  Fly   964 NVPLRDCLIDVDEIC 978
            |.||:.|    |..|
  Fly   155 NQPLQSC----DYTC 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31077NP_733185.2 CBM_14 43..81 CDD:279884
ChtBD2 <212..245 CDD:214696
CBM_14 267..308 CDD:279884
CBM_14 439..472 CDD:279884
CBM_14 733..769 CDD:279884
CBM_14 881..914 CDD:279884 11/39 (28%)
CG42397NP_001163428.1 CBM_14 58..102 CDD:279884 12/43 (28%)
ChtBD2 125..163 CDD:214696 14/41 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.