DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31077 and CG17147

DIOPT Version :9

Sequence 1:NP_733185.2 Gene:CG31077 / 318583 FlyBaseID:FBgn0051077 Length:988 Species:Drosophila melanogaster
Sequence 2:NP_001262099.1 Gene:CG17147 / 40216 FlyBaseID:FBgn0260393 Length:337 Species:Drosophila melanogaster


Alignment Length:406 Identity:97/406 - (23%)
Similarity:146/406 - (35%) Gaps:136/406 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 IGSYFEPIFKLCQLDENGVCSSSSSECTDGEVRVDPNNCAGYFNCENGRLITKTCPSGTYFEPTY 242
            :|.|.|    ||:|.:||.           :|| .|..|..|..|.:|.....||||...|.|: 
  Fly    25 VGEYEE----LCRLFKNGT-----------KVR-KPGTCDQYIQCYDGNGTVLTCPSNQSFNPS- 72

  Fly   243 KTCTVDLKGVCVEPPA--------KC--TEGQLKIDPNNCAGYLKCIDGEFVEEKCPGGTYYDFK 297
                   ||.||:..|        :|  .:|:...||..|..|..|::|..:...||.|.::|.:
  Fly    73 -------KGSCVDTLANSNKYCGNRCEGLDGEWVADPTECHKYFYCMNGVPLAGMCPVGQHFDER 130

  Fly   298 LETCLVDTEGVCVTIRKLC---IEGLREKDPKDCAAYTQCIR-GRVESVMC----DSGRYFNVTQ 354
            .::||...:.:||.:..:|   .|..:.::.||||.|.:|.: |...|..|    ....||:|..
  Fly   131 SQSCLYGVDSMCVDVNNICELVAENTKFRNEKDCAYYYECDKTGNHASKSCTVTSKKREYFDVES 195

  Fly   355 GECLADLYEVCLKSRKEHFRIVEHHQYDESTTPNSYQQTESTDADFQSTDSALQEVTSQNSCIFD 419
            |.|:......|....||:.                  .|.||...|:|                 
  Fly   196 GNCVEANKVECTAHSKENV------------------CTSSTTMTFKS----------------- 225

  Fly   420 LNGACVGQSTICTEGKKQRDINNCAGYLKC------IDGEFVEEECPESTYYDSNLETC-----L 473
                               |...|.||..|      .|.:.:..:|||..::|.:.:.|     :
  Fly   226 -------------------DQATCRGYFVCKALYPVADLDPLWTQCPEGYFFDEDRQLCANPTTV 271

  Fly   474 VDNYGAC-------VTSTSICVEGIVEEDPKDCAGYNQCVRGK-VEPLKCAFGRYFNGTQGECLI 530
            |..:..|       |||:|           .:|..|.:||..| |....|.:..:|:.|...|  
  Fly   272 VCTHNRCDGRGTMLVTSSS-----------NNCHNYIRCVDNKEVTEETCHWDHFFDETVEAC-- 323

  Fly   531 DLDEVCAKSSQVDYDR 546
                    ||::.||:
  Fly   324 --------SSKIIYDK 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31077NP_733185.2 CBM_14 43..81 CDD:279884
ChtBD2 <212..245 CDD:214696 11/32 (34%)
CBM_14 267..308 CDD:279884 12/40 (30%)
CBM_14 439..472 CDD:279884 10/38 (26%)
CBM_14 733..769 CDD:279884
CBM_14 881..914 CDD:279884
CG17147NP_001262099.1 ChtBD2 <44..77 CDD:214696 13/40 (33%)
ChtBD2 89..136 CDD:214696 13/46 (28%)
CBM_14 278..332 CDD:279884 19/75 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444051
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.