DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31077 and CG7017

DIOPT Version :9

Sequence 1:NP_733185.2 Gene:CG31077 / 318583 FlyBaseID:FBgn0051077 Length:988 Species:Drosophila melanogaster
Sequence 2:NP_001262095.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster


Alignment Length:316 Identity:82/316 - (25%)
Similarity:127/316 - (40%) Gaps:64/316 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 NDCMSYVKCIRGDLVRQR--CPAGSNFNVISKNCQMSRTGSCASP---------KEIC---LEGE 152
            |.|.::|:|.....|.::  |.||.|:|.....|.::.:.:...|         ..:|   .||.
  Fly    46 NTCDNWVRCASNYSVLEQGGCAAGLNYNKELGRCILASSSAAVCPYADSIADKATNLCANETEGA 110

  Fly   153 LQVD--SEDCAGYLECLNGGLVKEKCPIGSYFEPIFKLCQLDENGVCSSSSSECTDGEVRVDPNN 215
            ..||  |.||.||:.|.:...:|..||....|.|:.:.|..::...|..|.::.|....|..|||
  Fly   111 FIVDPSSSDCRGYILCKSHKQIKANCPNELIFHPVSRSCVYEKQYRCPISQTKKTSPACRSLPNN 175

  Fly   216 --------CAGYFNCENGRLITKTCPSGTYFEPTYKTCTVDLKGV-CVEPPAK-------CTE-- 262
                    |..|:.|.:..|.::.||..:.::.....| ||:..| |.|..|.       |.:  
  Fly   176 TRLADPVHCDQYYECVSEVLHSRACPVASAYDANLGYC-VDVAEVSCYESAALPEPENTFCLDSA 239

  Fly   263 -GQLKI----DPNNCAGYLKC---IDGEFVEE----KCPGGTYYDFKLETCLVDTEGV------C 309
             |..::    |..:|:.|..|   :.|:...|    .||.|.|:||:..:|. |...|      |
  Fly   240 TGSARVGYFADDESCSHYYICGSPVAGKHDTEPKHLSCPLGQYFDFEKLSCR-DRLNVRCQLDRC 303

  Fly   310 V--TIRKLCIEGLREKDPKDCAAYTQCIRGRVESV-MCDSGRYFNVTQGECLADLY 362
            |  .|..:.:.|       ||.:|.:|..|...|: .|.:|.||:.....|....|
  Fly   304 VGTNITYVNVAG-------DCQSYGRCSGGVTVSLGQCPTGYYFDERNQGCTQTNY 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31077NP_733185.2 CBM_14 43..81 CDD:279884
ChtBD2 <212..245 CDD:214696 9/40 (23%)
CBM_14 267..308 CDD:279884 14/51 (27%)
CBM_14 439..472 CDD:279884
CBM_14 733..769 CDD:279884
CBM_14 881..914 CDD:279884
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884 17/51 (33%)
ChtBD2 246..290 CDD:214696 12/43 (28%)
CBM_14 303..348 CDD:279884 14/51 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443997
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.