DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31077 and obst-F

DIOPT Version :9

Sequence 1:NP_733185.2 Gene:CG31077 / 318583 FlyBaseID:FBgn0051077 Length:988 Species:Drosophila melanogaster
Sequence 2:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster


Alignment Length:307 Identity:66/307 - (21%)
Similarity:99/307 - (32%) Gaps:62/307 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   647 EGIREVNPQDCAGYIECFGGVAKELKCDSGRYFNETQRNCSVDVDEICL---------------- 695
            ||....:|.||.||..| ..|...|.||.|..|:|.:..|.:..:..|.                
  Fly    48 EGDLVPHPLDCNGYFSC-SRVPTLLYCDQGLQFDENRAICDLPENTNCRPVATGTVESANGLADN 111

  Fly   696 -------KSDKTIVLDLQTTTESTPNFTTSVDP-FAKCRD-GQLRL-DPKNCAGFLKCVDGELKE 750
                   ...|.:.:.:..|:....|.....|| ..:||. |...| .|:||..:..|..|.|..
  Fly   112 SELNWWPHKPKPVFVAVDVTSGQPVNPMEKYDPEHIECRHYGAYFLPHPRNCGLYFICAYGHLHR 176

  Fly   751 EMCPSGFFYNSTSSKCMVDIRATC-----VTNIKYCIEGVREEDPNNCAGYRQCIRGLVQNLNCP 810
            ..|..|..:|...|:|.:..:|.|     ::.....:|...:....|..|               
  Fly   177 HQCGRGTAWNFEKSECQLSDQAICYGESQISEPHTDVETTMKVPTANSEG--------------- 226

  Fly   811 LGQYFNVAERDCLMDVHKVCARTEEVYKSDEVQHNDTGPPMTKPDESCIRDINGVCVDPLAKCRE 875
                   |...|.:.........::...|.|:...   ||:|.|  |..|........|..|...
  Fly   227 -------AVTVCYIVGSSEYTTLQQFLTSPEITEL---PPVTPP--SPPRAEANALTCPSTKQSY 279

  Fly   876 GQHKLDPNNCAGYLKCQNGELIEELCPNGFYYDFLMKICLVDRRGIC 922
            ..|   |.:|:.|..|..|..:...||.|.::|.....|.:::...|
  Fly   280 MSH---PEDCSKYYICIGGMPVLTSCPKGLFWDQKSGFCEMEKNVKC 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31077NP_733185.2 CBM_14 43..81 CDD:279884
ChtBD2 <212..245 CDD:214696
CBM_14 267..308 CDD:279884
CBM_14 439..472 CDD:279884
CBM_14 733..769 CDD:279884 11/35 (31%)
CBM_14 881..914 CDD:279884 9/32 (28%)
obst-FNP_649186.1 CBM_14 43..94 CDD:279884 16/46 (35%)
CBM_14 156..198 CDD:279884 12/41 (29%)
CBM_14 272..321 CDD:279884 13/51 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472927
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.