DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31077 and obst-J

DIOPT Version :9

Sequence 1:NP_733185.2 Gene:CG31077 / 318583 FlyBaseID:FBgn0051077 Length:988 Species:Drosophila melanogaster
Sequence 2:NP_649179.2 Gene:obst-J / 40202 FlyBaseID:FBgn0036940 Length:353 Species:Drosophila melanogaster


Alignment Length:295 Identity:75/295 - (25%)
Similarity:112/295 - (37%) Gaps:69/295 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 CMSYVKCIRGD---LVRQRCPAGSNFNVISKNCQMSRTGSCASPKEIC-LEGELQVDSEDCAGYL 164
            |..:..|...|   .....|||..:|   ||...:...|:|......| |...::....||..|.
  Fly    45 CQRFYVCTGDDDMPFQEFNCPAEYHF---SKKLMICVPGACTDESVFCGLTNSVERVQSDCTRYR 106

  Fly   165 ECLNGG-LVKEKCPIGSYFEPIFKLCQLDENGVCSSSSSECT----DGEVRVDPNNCAGYFNCEN 224
            :||.|| ....||.:|:||:|..:.|.    .|..|::.:|:    |.....:|::|..||.|.:
  Fly   107 QCLEGGSFAVAKCSVGNYFDPARRACL----PVAISAAHQCSCVLPDNATLANPSDCETYFRCHS 167

  Fly   225 GRLITKTCPSGTYFEPTYKTCTVDLKGVCVEPPA---KCTEGQLKIDPNNCAGYLKCIDGEFVEE 286
            |:.....||||.||:....:|..|..|:|:|.|.   ..||..|.:|.                 
  Fly   168 GQAELVQCPSGDYFDERVSSCVPDHTGICLEKPTMPPTLTEQALAMDE----------------- 215

  Fly   287 KCPGGTYYDFKLETCLVDTEGVCVTIRKLCIEGLREKDP--KDCAAYTQCIRGRVESVMCDSGRY 349
                                         ||.......|  :||..|..|.:.||..:.|..|:|
  Fly   216 -----------------------------CIRTGSRLAPHSRDCQRYYICAKKRVLEMRCPRGQY 251

  Fly   350 FNVTQGECLADLYEVC--LKSRKEHFRIVEHHQYD 382
            |:|.:..|..||...|  |::.|:...:.|:.|.:
  Fly   252 FDVVRRYCALDLGSECQALQAEKQDLELEENIQVE 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31077NP_733185.2 CBM_14 43..81 CDD:279884
ChtBD2 <212..245 CDD:214696 12/32 (38%)
CBM_14 267..308 CDD:279884 1/40 (3%)
CBM_14 439..472 CDD:279884
CBM_14 733..769 CDD:279884
CBM_14 881..914 CDD:279884
obst-JNP_649179.2 ChtBD2 <40..79 CDD:214696 9/36 (25%)
CBM_14 145..192 CDD:279884 14/46 (30%)
CBM_14 216..259 CDD:279884 14/42 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444099
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D29657at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.