DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31077 and CG10154

DIOPT Version :9

Sequence 1:NP_733185.2 Gene:CG31077 / 318583 FlyBaseID:FBgn0051077 Length:988 Species:Drosophila melanogaster
Sequence 2:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster


Alignment Length:315 Identity:71/315 - (22%)
Similarity:109/315 - (34%) Gaps:95/315 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IKDSVKCTEGSVAADIDD---------CASYFQCIDDETV-------------------HLNCAN 66
            |.|..:.|:.:|..::.|         |:.|.:| ::.|:                   :.:|..
  Fly    46 IYDMYENTQINVCGNVADGVYLPYVGNCSKYIEC-ENNTIKEVGSCLDLAKDNPDICDPNKSCEL 109

  Fly    67 GSYFEASNEICV-VDEFGVCPT--SRRL---CFDGDIFEDINDCMSYVKCIRGDLVRQRCPAGSN 125
            |  ::...::|. ::|....||  |.||   |:|       |.|..||.|..|..|.::|..|..
  Fly   110 G--YDPVLQVCTYMEEVQCLPTCESFRLSSFCYD-------NTCTKYVLCYYGKPVLRQCHDGLQ 165

  Fly   126 FNVISKNCQMSRTGSCAS--------PKEICLEGELQVDSEDCAGYLECLNGGLVKEKCPIGSYF 182
            :|..:..|.......|.:        |::|...|    ....|:.|..|.||...:::|..|..:
  Fly   166 YNNATDRCDFPEYVDCVANDCSATFQPEDIIYLG----SKASCSKYYVCSNGHPWEQQCAPGLAY 226

  Fly   183 EPIFKLCQLDENGVCSSSSSECTDGEVRVDPNNCAGYFNCENGRLITKTCP-SGTYFEPTYKTCT 246
            .|..|.|...:|..|:      .|...|    |...|......|...| || .||:|.|      
  Fly   227 NPSCKCCDFAKNVNCT------IDAVAR----NILPYSRTPLRRADIK-CPLMGTHFFP------ 274

  Fly   247 VDLKGVCVEPPAKCTEGQLKIDPNNCAGYLKCIDGEFVEEKCPGGTYYDFKLETC 301
                                 ..:....|..|::|..|...|..|.|||.|:|.|
  Fly   275 ---------------------HKSRRDAYYYCVEGRGVTLDCTPGLYYDPKVEDC 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31077NP_733185.2 CBM_14 43..81 CDD:279884 8/66 (12%)
ChtBD2 <212..245 CDD:214696 10/33 (30%)
CBM_14 267..308 CDD:279884 12/35 (34%)
CBM_14 439..472 CDD:279884
CBM_14 733..769 CDD:279884
CBM_14 881..914 CDD:279884
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 16/56 (29%)
CBM_14 197..239 CDD:279884 11/45 (24%)
ChtBD2 263..311 CDD:214696 19/74 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444056
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D33909at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.