DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31077 and CG11570

DIOPT Version :9

Sequence 1:NP_733185.2 Gene:CG31077 / 318583 FlyBaseID:FBgn0051077 Length:988 Species:Drosophila melanogaster
Sequence 2:NP_001356902.1 Gene:CG11570 / 39357 FlyBaseID:FBgn0036230 Length:262 Species:Drosophila melanogaster


Alignment Length:262 Identity:48/262 - (18%)
Similarity:80/262 - (30%) Gaps:79/262 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   441 NNCAGYLKCIDGEFVEEECPESTYYDSNLETCLVDNYGAC---VTSTSICVEGIVEEDPKDCAGY 502
            |:|:.|..|..|...|::||.:.::......|....|..|   :.|.:..||.|....|.||..:
  Fly    54 NDCSKYYVCQKGRAYEQQCPLNLFWSQMTYRCDYKEYSNCNTYIPSPNHDVEVIFSAYPGDCRRF 118

  Fly   503 NQCVRGKVEPLKCAFGRYFNGTQGECLIDLDEVCAKSSQVDYDRDLEQFQYSQSTSEYLLEYTNT 567
            .:     ...|:|.....::.....|::.....|               |.|..|...::.:|..
  Fly   119 YE-----TRILRCEQNLQWSSVYQRCVVPQYGDC---------------QNSPVTVPPVVPFTPL 163

  Fly   568 DT---------TIADFSTESSNADFNRYTDSNSYTDTESTTNDVPTSTEVSTFDLKTTDLSLQFT 623
            .|         |:..:                   |...|....|..|.:.:..|.         
  Fly   164 PTYPPVPTVPATVIPY-------------------DPMPTAGTPPPITPMESLPLP--------- 200

  Fly   624 TLDGVDNLDINTGTCVYNNT---LFIEGIREVNPQDCAGYIECFGGVAKELKCDSGRYFNETQRN 685
                   :|:.:   :.||:   .:|.     .|..|..:|.| |..|..|.|.....:|..|..
  Fly   201 -------IDVQS---LCNNSPPNAYIP-----YPGSCKKFIHC-GPTATILSCAGSSNWNPAQHA 249

  Fly   686 CS 687
            |:
  Fly   250 CT 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31077NP_733185.2 CBM_14 43..81 CDD:279884
ChtBD2 <212..245 CDD:214696
CBM_14 267..308 CDD:279884
CBM_14 439..472 CDD:279884 8/30 (27%)
CBM_14 733..769 CDD:279884
CBM_14 881..914 CDD:279884
CG11570NP_001356902.1 CBM_14 51..93 CDD:307643 10/38 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D33909at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.