DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31077 and obst-G

DIOPT Version :9

Sequence 1:NP_733185.2 Gene:CG31077 / 318583 FlyBaseID:FBgn0051077 Length:988 Species:Drosophila melanogaster
Sequence 2:NP_648529.1 Gene:obst-G / 39355 FlyBaseID:FBgn0036228 Length:279 Species:Drosophila melanogaster


Alignment Length:330 Identity:73/330 - (22%)
Similarity:107/330 - (32%) Gaps:87/330 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   611 FDLKTTDLSLQFTTLDGVDN-LDINTGTCVYNN----TLFIEGIREVNPQDCAGYIECFGGVAKE 670
            |.|....|.||.:||..|.| ....|..|...|    .:|         ..|.||..|..|.|..
  Fly     4 FGLLCVMLVLQESTLAVVQNGFAFKTSLCEGKNGGLLPMF---------GSCKGYYVCADGNAVT 59

  Fly   671 LKCDSGRYFNETQRNCSVDVDEI-CLKSDKTIVLDLQTTTESTPNFTTSVDPFAKCRDGQLRLDP 734
            ..|:....||....:|. |.|.: |:...|..::|..:::||                       
  Fly    60 GTCEKNTLFNPLTLHCD-DPDNVDCIFDGKDNIVDDTSSSES----------------------- 100

  Fly   735 KNCAGFLKCVDGELKEEMCPSGFFYNSTSSKCMVDIRAT----CVTNIKYCI---EGVREEDPNN 792
                      |.:..|||         ..:...|.::||    ..|..|.|.   :||......:
  Fly   101 ----------DEDDDEEM---------AKTDPPVTVKATKKPRPTTLDKMCAGKKDGVMLTKNGS 146

  Fly   793 CAGYRQCIRGLVQNLNCPLGQYFNVAERDCLMDVHKVCA-RTEEVYKSDEVQHNDTGPPMTKPDE 856
            |..|..|........:||..|:|:...|.|:......|: .|.|..:||       ||..|    
  Fly   147 CQEYYVCKAKKPHLRSCPDKQHFSPTRRICMKASEAKCSGGTRENKESD-------GPATT---- 200

  Fly   857 SCIRDINGVCVDPLAKCREGQHKLDPNNCAGYLKCQNGELIEELCPNGFYYDFLMKICLVDRRGI 921
                  .|||.|.    :|.......::|..::.|.|...:...||.|.:::.....|...:...
  Fly   201 ------GGVCSDE----KENSLVAHRSDCGKFMLCSNMMFLVMDCPTGLHFNIATSRCDYPKIAK 255

  Fly   922 CVTNI 926
            |.|.:
  Fly   256 CQTKL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31077NP_733185.2 CBM_14 43..81 CDD:279884
ChtBD2 <212..245 CDD:214696
CBM_14 267..308 CDD:279884
CBM_14 439..472 CDD:279884
CBM_14 733..769 CDD:279884 4/35 (11%)
CBM_14 881..914 CDD:279884 6/32 (19%)
obst-GNP_648529.1 CBM_14 32..83 CDD:279884 15/60 (25%)
CBM_14 132..184 CDD:279884 12/51 (24%)
CBM_14 204..256 CDD:279884 10/55 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444059
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D33909at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.