DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31077 and CG13312

DIOPT Version :9

Sequence 1:NP_733185.2 Gene:CG31077 / 318583 FlyBaseID:FBgn0051077 Length:988 Species:Drosophila melanogaster
Sequence 2:NP_648260.1 Gene:CG13312 / 39010 FlyBaseID:FBgn0035931 Length:342 Species:Drosophila melanogaster


Alignment Length:405 Identity:84/405 - (20%)
Similarity:124/405 - (30%) Gaps:138/405 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   472 CLVDN-YGACVTSTSICVEGIVEEDPKDCAGYNQCVRGKVEPLKCAFGRYFNGTQGECLIDLDEV 535
            |||.: :|.|                      |.|  ..|..|.|     ::.||          
  Fly    21 CLVSSTHGTC----------------------NVC--NTVNNLTC-----YSSTQ---------- 46

  Fly   536 CAKSSQVDYDRDLEQFQYSQSTSEYLLEYTNTDTTIADFSTESSNADFNRYTDSNSYTDTESTTN 600
             .:|.|||                .|...|.||..........|:....:..||.|  |:::...
  Fly    47 -MQSCQVD----------------VLSTATPTDCPSGYVCVSGSSGVLCQPEDSAS--DSQADCQ 92

  Fly   601 DVPTSTEVSTFDLKTTDLSLQFTTLDGVDNLDINTGTCVYNNTLFIEGIREVNPQDCAGYIECFG 665
            :.....|..||....|.   .|....|.|.:..:.|||                  .:||:    
  Fly    93 ECNKCDETQTFACTGTQ---SFALCLGTDTVQDSVGTC------------------ASGYV---- 132

  Fly   666 GVAKELKCDSGRYFNETQRNCSVDVDEI---CLKSDKTIVLDLQTTTEST---PNFTTSVDPFAK 724
                   |:    .|:|| .|.:..|.:   |..||.:....:.:||.||   |..|:|...:..
  Fly   133 -------CN----INDTQ-ICGLPADGVMPTCSYSDDSTTTTVSSTTSSTTAAPPSTSSASTYCA 185

  Fly   725 CRDGQLRLDP-----KNCAGFLKC--VDGEL--KEEMCPSGFFYNSTSSKCMVDIRATCVTNI-- 778
            ....|.:...     ..|..::.|  |||..  :...||...:::|.|..|:..:.:||.|..  
  Fly   186 AVQSQGKYAVGYNAYTTCRQYIYCTLVDGSWIGQTYTCPGSMYFDSASEMCVSTMPSTCSTTATT 250

  Fly   779 --------------KYC-------IEGVREEDPNNCAGYRQC-IRGLVQNLN---CPLGQYFNVA 818
                          .||       ...|..:....|..|..| :.|.....|   ||...|:|.|
  Fly   251 SSTTTAAPTTSNPEAYCQAMQSAGYYPVGTDASTTCHQYIDCFLNGGTWGGNMYTCPGSLYYNSA 315

  Fly   819 ERDCLMDVHKVCART 833
            .|.|:..:...|:.|
  Fly   316 SRTCVSTLPSTCSTT 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31077NP_733185.2 CBM_14 43..81 CDD:279884
ChtBD2 <212..245 CDD:214696
CBM_14 267..308 CDD:279884
CBM_14 439..472 CDD:279884 84/405 (21%)
CBM_14 733..769 CDD:279884 10/44 (23%)
CBM_14 881..914 CDD:279884
CG13312NP_648260.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.