DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31077 and CG32302

DIOPT Version :9

Sequence 1:NP_733185.2 Gene:CG31077 / 318583 FlyBaseID:FBgn0051077 Length:988 Species:Drosophila melanogaster
Sequence 2:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster


Alignment Length:354 Identity:81/354 - (22%)
Similarity:127/354 - (35%) Gaps:81/354 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ISAWICLMRPSFGSIIKDSVKCTEGSVAADIDDCAS--YFQCIDDETVHLNCANGSYFEASNEIC 77
            |..::|:...:.|..|:|:....|   ...:..|.|  .|.|.|:.|.      |..|::.   |
  Fly    31 IPGFVCMNCTTLGYCIRDATGSWE---TISMLGCQSEYNFYCSDEGTF------GCTFQSQ---C 83

  Fly    78 VVDEFGVCPTSRRLCFDGDIFEDINDCMSYVKCIRGDLVRQR-CPAGSNFNVISKNCQMSRTGSC 141
            .|.:.|  |.|   |....:|.|..||..|.:|....:...| |..|:.::.:        ||:|
  Fly    84 QVPKRG--PFS---CQQAGLFPDPYDCRRYHECSDQSVDTPRICSNGAGYSTL--------TGTC 135

  Fly   142 ASPKEICLEGELQVDSEDC-AGYLECLNGGLVKEKCPIGSYFEPIFKLCQLDENGVCSSSSSECT 205
            ..|:|          ||.| .....|...|.|....|...|    |.:|..|..........:|.
  Fly   136 VLPRE----------SEQCIQEQFTCSRSGQVGGWAPDNRY----FYVCVNDTANSLYPLMMKCH 186

  Fly   206 DGEVRVDPNNCAGYFNCENGRLI----TKTCPSGTYFEPTYKTCTVDLKGVCVEPPAKCTEGQLK 266
            :|.| .:..:|..  :..:.|.|    :.||.:...::..::|..::                  
  Fly   187 EGFV-FNSYSCVP--DTRSMRSIQAMESHTCMNNDRYQCPFRTSEIE------------------ 230

  Fly   267 IDPNNCAGYLKCIDGEFVEEKCPGGTYYDFKLETCLVDTEGVCVTIRKLCIEGLREKDPKDCAAY 331
                    |.||:|||.....||.|...|.|:.||:.|....|.....|....:..||     .|
  Fly   231 --------YCKCVDGELEVMTCPAGFQIDPKILTCVTDRIYQCSDFEILSCPNVSTKD-----EY 282

  Fly   332 TQCIRGRVESVMCDSGRYFNVTQGECLAD 360
            ..||..:::...|..|:|||....:|.::
  Fly   283 CICIDHQLQIYSCPMGQYFNAETRKCQSE 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31077NP_733185.2 CBM_14 43..81 CDD:279884 10/39 (26%)
ChtBD2 <212..245 CDD:214696 5/36 (14%)
CBM_14 267..308 CDD:279884 14/40 (35%)
CBM_14 439..472 CDD:279884
CBM_14 733..769 CDD:279884
CBM_14 881..914 CDD:279884
CG32302NP_728732.1 CBM_14 94..144 CDD:279884 16/67 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444055
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.