DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31077 and CG13806

DIOPT Version :9

Sequence 1:NP_733185.2 Gene:CG31077 / 318583 FlyBaseID:FBgn0051077 Length:988 Species:Drosophila melanogaster
Sequence 2:NP_647708.1 Gene:CG13806 / 38292 FlyBaseID:FBgn0035325 Length:297 Species:Drosophila melanogaster


Alignment Length:322 Identity:78/322 - (24%)
Similarity:111/322 - (34%) Gaps:93/322 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 CLMRPSFGSI------IKDSVKCTEGSVAADIDDCASYFQCIDDETVHLNCANGSYFEA-----S 73
            |..|.|.|.|      :...|:.:.|.|...::.|              :.|||.|..|     :
  Fly    37 CEGRQSPGPICESCELLATCVRHSNGWVNIPVESC--------------DVANGYYCNARLGSCT 87

  Fly    74 NEICVVDEFGVCPTSRRLCFDGDIFEDINDCMSYVKC--IRGDLVRQRCPAGSN--FNVISKNCQ 134
            ||......||:  .....|....||.|..||..|..|  :...||......|::  |:..:..|.
  Fly    88 NETGPCHPFGI--EGNFQCTSQGIFPDPYDCQKYHMCYFVGATLVAAAVDCGNDKAFDATTGQCT 150

  Fly   135 MSRTGSCASPKEICLEGELQVDSEDCAGYLECLNGGLVKEKCPIGSYFEPIFKLCQ------LDE 193
            ::.|.|      :||:.:..           |.|.|.| ...|..   ..||.:|:      |::
  Fly   151 LTLTDS------VCLQRQYY-----------CPNAGHV-AAWPTN---PNIFYVCKSTVNQNLND 194

  Fly   194 NGVCSSSSSECTDGEVRVDPNNCAGYFNCENGRLITKTCPSGTYFEPTYKTCTVDLKGVCVEP-- 256
            ..|...|...|.|||..||       :.|.:|   :...|..|           |...|.:|.  
  Fly   195 TIVIYPSLHRCNDGETFVD-------YVCRSG---SNVLPPST-----------DDPSVIIEDPN 238

  Fly   257 -------PAKCTEGQLKIDPNNCAGYLKC--IDGEFVEEKCPGGTYYDFKLETCLVDTEGVC 309
                   |..|....|..|.|:|..|..|  ::|......||.||||..:|.:|::   |.|
  Fly   239 DDDFSVLPNTCQHVGLMADGNDCRKYYYCSALNGTLRHMDCPNGTYYRPELSSCVL---GSC 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31077NP_733185.2 CBM_14 43..81 CDD:279884 8/42 (19%)
ChtBD2 <212..245 CDD:214696 5/32 (16%)
CBM_14 267..308 CDD:279884 14/42 (33%)
CBM_14 439..472 CDD:279884
CBM_14 733..769 CDD:279884
CBM_14 881..914 CDD:279884
CG13806NP_647708.1 CBM_14 105..158 CDD:279884 14/58 (24%)
ChtBD2 247..293 CDD:214696 15/45 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443982
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.