DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31077 and CG33263

DIOPT Version :9

Sequence 1:NP_733185.2 Gene:CG31077 / 318583 FlyBaseID:FBgn0051077 Length:988 Species:Drosophila melanogaster
Sequence 2:NP_996072.1 Gene:CG33263 / 2768952 FlyBaseID:FBgn0053263 Length:227 Species:Drosophila melanogaster


Alignment Length:185 Identity:46/185 - (24%)
Similarity:69/185 - (37%) Gaps:36/185 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 EDCAGYLECLNGGLVKEKCPIGSYFEPIFKLCQLDENGVCSSSSSEC---------TDGE----- 208
            ||||.|:.|......::.||..:||:...:.|..|:.|||..:|...         |.||     
  Fly    41 EDCASYIYCNGEDSFRDSCPESTYFDDRTQECAFDDEGVCLRNSDSVQTEEQPDKQTTGEEQSGI 105

  Fly   209 -----VRVDPNNCA-------GYFNCENGRLITKTCPSGTYFEPTYKTCTVDLKGVCVEPPAK-- 259
                 |...|::.|       ..|..::....|::.||.|  ||...:.|..........||:  
  Fly   106 EETTPVPTPPSDYASTGSADSSTFQADSTTTPTESIPSVT--EPPTTSATPSSPSAKPSSPAQER 168

  Fly   260 --CT---EGQLKIDPNNCAGYLKCIDGEFVEEKCPGGTYYDFKLETCLVDTEGVC 309
              |.   :|. ...|..|..|.:|:.|.....:||....:||..:.|...:|..|
  Fly   169 PHCDISGDGD-HPHPQRCEYYYRCLSGYLTIVRCPYKYGWDFPTKQCKPSSEAQC 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31077NP_733185.2 CBM_14 43..81 CDD:279884
ChtBD2 <212..245 CDD:214696 9/39 (23%)
CBM_14 267..308 CDD:279884 11/40 (28%)
CBM_14 439..472 CDD:279884
CBM_14 733..769 CDD:279884
CBM_14 881..914 CDD:279884
CG33263NP_996072.1 CBM_14 28..79 CDD:279884 12/37 (32%)
CBM_14 171..222 CDD:279884 13/51 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.