DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31077 and CG43294

DIOPT Version :9

Sequence 1:NP_733185.2 Gene:CG31077 / 318583 FlyBaseID:FBgn0051077 Length:988 Species:Drosophila melanogaster
Sequence 2:NP_001356903.1 Gene:CG43294 / 12798218 FlyBaseID:FBgn0262986 Length:143 Species:Drosophila melanogaster


Alignment Length:139 Identity:30/139 - (21%)
Similarity:57/139 - (41%) Gaps:30/139 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   790 PNNCAGYRQCIRGLVQNLNCPLGQYFNVAERDCLMDVHKVCARTEEVYKSDEVQHNDTGPPMTKP 854
            ||:|..|.:     .:.|:||...|:|.....|.......|:..:.:...:....|  .||:.:|
  Fly    30 PNDCHRYYE-----TRLLDCPPEFYWNSQLLQCNSQTPVGCSSIDPITNWNNSYPN--SPPIKEP 87

  Fly   855 DESCIRDINGVCVDPLAKCREGQHKLD-----PNNCAGYLKCQNGELIEELCPNGFYYDFLMKIC 914
            :.|   |:..:|          ::||:     |.:|..:::|.....: ..||...|::..:..|
  Fly    88 ENS---DLTKLC----------ENKLNQLIPYPADCTKFIRCDYLPFV-MCCPQYLYWNSQLLTC 138

  Fly   915 LVDRRGICV 923
              |:  :||
  Fly   139 --DK--MCV 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31077NP_733185.2 CBM_14 43..81 CDD:279884
ChtBD2 <212..245 CDD:214696
CBM_14 267..308 CDD:279884
CBM_14 439..472 CDD:279884
CBM_14 733..769 CDD:279884
CBM_14 881..914 CDD:279884 6/37 (16%)
CG43294NP_001356903.1 CBM_14 96..139 CDD:307643 10/55 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.