DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31077 and LOC110437948

DIOPT Version :9

Sequence 1:NP_733185.2 Gene:CG31077 / 318583 FlyBaseID:FBgn0051077 Length:988 Species:Drosophila melanogaster
Sequence 2:XP_021322240.1 Gene:LOC110437948 / 110437948 -ID:- Length:195 Species:Danio rerio


Alignment Length:234 Identity:47/234 - (20%)
Similarity:64/234 - (27%) Gaps:100/234 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   743 CVDGELKEEMCPSGFFYN-STSSKCMVDIRATCVTNIKYCIEGVREEDPNNCAGYRQCIRGLVQN 806
            |..|..:...|.||.|.. ..:|:|.     .|... .||.:|.|...|   ||: .|..|...:
Zfish    40 CPPGATRPVPCHSGTFVTVPQASQCW-----ACTAG-WYCADGGRLLCP---AGF-YCPEGTGYD 94

  Fly   807 LN-CPLGQYFNVAERDCLMDVHKVCARTEEVYKSDEVQHNDTGPPMTKPDESCIRDINGVCVDPL 870
            :. ||.|.|                                      .||...|         .|
Zfish    95 IRPCPAGTY--------------------------------------SPDSGLI---------SL 112

  Fly   871 AKCR--EGQHKLDPNNCAGYLKCQNGELIEELCPNGFYYDFLMKICLVDRRGICVTNIQICDEGA 933
            ::||  :|.|         |...||...:...|..|:|                      |.:|.
Zfish   113 SECRACDGGH---------YCSLQNSSSVTGQCSEGYY----------------------CAQGN 146

  Fly   934 LEEDPHD--------CAGYRQCIDGQVENLKCPFGTYFN 964
            :...|:.        |.....|..|..:...||.||:.|
Zfish   147 ISPQPYTQNTGVGGLCPVGHFCPQGTAQPQPCPEGTFSN 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31077NP_733185.2 CBM_14 43..81 CDD:279884
ChtBD2 <212..245 CDD:214696
CBM_14 267..308 CDD:279884
CBM_14 439..472 CDD:279884
CBM_14 733..769 CDD:279884 8/26 (31%)
CBM_14 881..914 CDD:279884 6/32 (19%)
LOC110437948XP_021322240.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.